KEGG   Helicobacter cetorum MIT 00-7128: HCW_05345Help
Entry
HCW_05345         CDS       T02032                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
hce  Helicobacter cetorum MIT 00-7128
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:hce00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    HCW_05345 (recR)
DNA repair and recombination proteins [BR:hce03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      HCW_05345 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1147310..1147891)
Genome map
AA seq 193 aa AA seqDB search
MNTYKNSLNHFLNLVDCLEKIPSVGKKSAFKMAYHLGLENPYLALKLTHALENALENLKT
CSSCNALSESEICEICSDESRQNSQLCMVLHPRDVFILEDLKDFLGRYYVLNSIEDLNFN
ALEKRLVEENIKEIIFAFPPTLANDSLMLYIEDKLQKFHLTFTKIAQGVPTGVNFENIDL
VSLSRAFNARIKA
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgaatacttataaaaacagcttgaatcattttttaaatttagtggattgtttggaaaaa
atcccaagtgtgggtaaaaaatctgcctttaaaatggcgtatcatttaggtttggaaaac
ccctatttggcactcaaactcactcacgctttagaaaatgccctagaaaatctcaaaaca
tgttcatcttgtaacgccttgagtgagagtgagatttgtgagatttgttctgatgaaagt
aggcaaaattctcagctttgcatggttttacacccaagagatgtgtttatcttagaagat
ttaaaggactttttaggacgctactatgtgctaaattccatagaagatttgaattttaac
gccctagaaaaacgcctagttgaagaaaatattaaagaaatcatctttgctttccccccc
actctagctaatgattctttaatgctctatatagaagataaattacaaaaatttcatctc
acttttactaaaatcgctcaaggcgtgcctactggagtgaattttgaaaacattgattta
gtctcactttcaagggcgtttaacgcaaggataaaagcatga

DBGET integrated database retrieval system