KEGG   Helicobacter cetorum MIT 00-7128: HCW_06115Help
Entry
HCW_06115         CDS       T02032                                 

Gene name
gmk
Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
hce  Helicobacter cetorum MIT 00-7128
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:hce00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    HCW_06115 (gmk)
Enzymes [BR:hce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     HCW_06115 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1319636..1320250
Genome map
AA seq 204 aa AA seqDB search
MNNHTNLLILSGPSGSGKSTLTKHLQENIPHMYFSISTTTRQKREGEIENLHYYFVSEEE
FKLGIEQGQFLEWAIVHNNYYGTSKAPVEQALKEGKIVIFDIDVQGHRDIKKHYPNACSV
FINTKDQETLKQRLISRGTDSKEIIQKRLVHAYNEMQCLKSFDYLIINENLEKSKEAILS
IAKTLAYRQKAFNFEKVCQEWKAH
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgaataatcacaccaatttgctgattctctcagggcctagtggctctgggaaaagcacc
cttacaaaacatttacaagaaaatatcccacacatgtatttttctatctccaccacaaca
cgccaaaagcgagagggcgaaatagaaaatttacactattattttgtaagcgaagaagag
tttaagcttggcatagagcaaggacaatttttagaatgggcaattgtgcataataattac
tatggcacttctaaagcccccgtagaacaagctcttaaagagggtaaaatcgttattttt
gatattgatgtgcaagggcatagagatattaaaaagcactaccctaacgcttgttcagtc
tttatcaataccaaagaccaagagaccttaaaacaacgcttaatttcaagaggcacagac
tcaaaagagattattcaaaaacgcttagtgcatgcttataatgaaatgcaatgccttaaa
agttttgattatcttatcatcaatgaaaatttagaaaagtccaaagaggcgattttaagc
attgcaaaaaccttagcataccgccaaaaagcgtttaattttgaaaaggtatgccaagaa
tggaaagcacattaa

  All links  
No link information was found.   
DBGET integrated database retrieval system