KEGG   Helicobacter cetorum MIT 00-7128: HCW_06775Help
Entry
HCW_06775         CDS       T02032                                 

Definition
thiol:disulfide interchange protein DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
hce  Helicobacter cetorum MIT 00-7128
Brite
Enzymes [BR:hce01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     HCW_06775
Secretion system [BR:hce02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   HCW_06775
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1460137..1460937)
Genome map
AA seq 266 aa AA seqDB search
MILRAVMLSALLAIGANATPTKSNPQEKLMQSNLKKVVEKQTGKKINVLELKTLKSTSEF
KIAVVEDPDTKYHIPLLVSKDGNLVVGLSNLFFSSKDSDVQMVNELNQKIQSFNVAQQNS
GKLNAIFEEIPSDYVIEFPSSDVKNRDKILYIVSDPMCPHCQKELTKLREHLKENTIRMV
IVGWLGANSAKKAAIIQEEMTQARARGANIEDKISIIEKVYSTQYDINAQKEPAGMRTKV
ETITKKIFDSGVIKYVPFLYEYKAKK
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgatattaagagctgttatgttaagcgcattacttgcaataggagcgaatgcaacccca
acaaaaagtaacccccaagaaaagctaatgcaaagcaatttaaagaaagttgttgagaaa
caaacgggtaaaaaaatcaatgttttagagctaaaaacattaaaatctacaagcgaattt
aaaattgctgttgtagaagaccctgatacgaaatatcatattccccttttagttagtaaa
gatggtaatttggttgtagggcttagcaatttattttttagcagtaaagattctgatgtg
caaatggttaatgagctaaatcaaaaaatccaatcttttaatgtagcgcaacaaaatagt
ggtaaattaaatgccatttttgaagagattcctagcgattatgtgatagagtttccatca
agtgatgtgaagaatagagataaaattctttatattgtatcagaccctatgtgtccgcat
tgtcaaaaagagctcactaagctaagagagcatttaaaagaaaatactataagaatggtt
attgtgggttggcttggagctaattcggctaaaaaggctgctatcattcaagaggaaatg
acacaagcaagagctagaggggcaaatatagaagataaaatttctatcattgagaaagta
tattccactcaatatgatattaacgcacaaaaagagccagcaggtatgcgcactaaagta
gaaacaatcactaagaagatttttgattctggcgtgattaaatatgtgcctttcttatat
gaatataaggctaaaaaatga

DBGET integrated database retrieval system