KEGG   Helicobacter cetorum MIT 00-7128: HCW_07315Help
Entry
HCW_07315         CDS       T02032                                 

Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
hce  Helicobacter cetorum MIT 00-7128
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hce00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    HCW_07315
Enzymes [BR:hce01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     HCW_07315
Exosome [BR:hce04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   HCW_07315
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1592009..1593046)
Genome map
AA seq 345 aa AA seqDB search
MFKRSKDTILKNFKREMMFKRLRRLRASANLRSLVAETYLRTQDFIAPLFVIEGNNIKNE
ISSMPGVYQMSIEHVLKECEELQSLGINTILLFGIPKEKDTLGSHALNENHIVAKATREI
KKRFPNLTIVADLCFCEYTEHGHCGILENGCVANDKTLEILNAQGLILAESGIDLLAPSN
MMDGNVLSLRKALDGAGFSHMPIMSYSTKFASSYYGPFRDVANSAPSFGDRKSYQMDYAN
RKEALLESLEDEKQGADILMVKPALAYLDIVREIRNHTLLPLAVYNVSGEYAMLKLAQKH
NLIHYENTLLETMTCFKRAGADIIISYHAKEVAILLRKELNGKSI
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
ttgtttaagagaagtaaagatacaatattaaaaaatttcaaaagagagatgatgtttaaa
agactgagacgattacgagctagtgctaatttacgctctttagtggctgaaacatattta
agaacacaagattttatcgcccccttgtttgtcatagaaggcaataacattaaaaatgag
attagctccatgcctggagtgtatcaaatgagtattgagcatgttttaaaagagtgcgaa
gaattacaaagtttaggcataaatacaatcttgctttttggcatacctaaagaaaaagac
acactaggtagccatgccttaaatgaaaatcatattgtagccaaagcaactagagaaatt
aaaaaacgatttcctaatctaactattgtggcggatttgtgcttttgcgaatacactgag
catgggcattgtgggattttagaaaatggctgtgtagctaatgataaaacactagagatt
ttaaacgctcaaggactaatcttagcagaaagtggaatagatttgcttgctccaagcaac
atgatggatgggaatgtgctaagtttaagaaaagccctagatggtgcaggtttttcgcat
atgcctattatgagctattctactaagtttgctagtagctattatgggccttttagagat
gtggccaactccgctccaagttttggggatagaaagagctatcaaatggattatgccaac
agaaaagaagcccttttagaaagcttagaagatgaaaagcaaggggcggatattttaatg
gtaaagcccgctttagcgtatttagatattgttagagagattagaaatcatactttacta
cccttagcggtgtataatgtgagtggggaatatgcgatgttaaaacttgctcaaaagcac
aacttaatccattatgaaaacaccctattagaaacgatgacttgctttaaaagagcgggt
gcagatattattatcagctatcatgccaaagaagtggcaattttattaagaaaggaatta
aatgggaagagcatttga

DBGET integrated database retrieval system