KEGG   Helicobacter cetorum MIT 00-7128: HCW_07995Help
Entry
HCW_07995         CDS       T02032                                 

Gene name
glk
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
hce  Helicobacter cetorum MIT 00-7128
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hce00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HCW_07995 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HCW_07995 (glk)
   00052 Galactose metabolism
    HCW_07995 (glk)
   00500 Starch and sucrose metabolism
    HCW_07995 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    HCW_07995 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    HCW_07995 (glk)
   00524 Butirosin and neomycin biosynthesis
    HCW_07995 (glk)
Enzymes [BR:hce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     HCW_07995 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1755323..1756324
Genome map
AA seq 333 aa AA seqDB search
MPKTKTYPRLLADIGGTNARFGLEIAPRQIECIEVLQCKDFESLSDAVRFYLSKYKENLK
LHPLYGSFAVATPIMGDFVQMTNNHWTFSIETTRQCLGLEKLLVINDFEAQAYAISAMQE
SDLAQVGGIKCEINAPKAILGPGTGLGVSTLIHNSDGSLKVLPGEGGHVSFAPFDDLEIL
VWQYARSKFNHVSAERFLSGSGLVLIYEALSKRKGMEKAAKLSKAELTPQIISERALNGD
YPLCRLTLDTFCAMLGTLAADVALTLGARGGVYLCGGIIPRFIDYFKTSPFRVRFETKGR
MGAFLASIPVHVVLKKTPGLDGAGIALENYLLN
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgccaaagactaaaacttacccaagactattagcggatatcggtggcacaaacgcacgc
tttggcttagaaatcgccccacgacaaattgagtgcattgaagtcttacaatgtaaagat
tttgagagcttaagcgatgcagtgcgtttctatctctccaaatataaagaaaatcttaaa
ttgcaccccctttatggctcttttgctgtggctacgcccattatgggcgattttgtccaa
atgactaacaaccactggactttttctatagaaaccacaaggcaatgtttgggcttagaa
aaattgcttgtaatcaatgattttgaagcacaagcctatgccattagtgcgatgcaagaa
agcgatttagctcaagtgggtggaatcaaatgtgaaatcaacgcccctaaagccatttta
gggccaggaactgggctaggggtaagcactcttattcataatagtgatggctctttaaaa
gtattgcccggcgaaggggggcatgtgagctttgccccttttgatgatttggaaatttta
gtgtggcaatacgctcgctccaaattcaatcatgtgagtgcggaaaggtttttgagtggg
agtggcttggtgctgatttatgaagccctatctaagcgaaagggcatggaaaaagcagcc
aagttaagtaaggctgagctgaccccacaaattattagcgaacgggctttgaatggggat
tatcctttgtgcagattaactttagacactttttgtgcgatgctaggcacactagcggct
gatgtggctcttaccttaggtgctaggggaggcgtgtatttgtgtgggggaatcattcca
cgatttattgattattttaaaacttcgccttttagagtgcgttttgagactaaggggcgt
atgggggcgtttctagcttctattcctgtgcatgtcgtgttgaaaaaaactcccggactt
gatggagcaggcattgcgttagagaattatttgctaaactga

DBGET integrated database retrieval system