KEGG   Helicobacter cetorum MIT 00-7128: HCW_08665Help
Entry
HCW_08665         CDS       T02032                                 

Definition
(GenBank) pyruvate flavodoxin oxidoreductase subunit gamma
  KO
K00172  pyruvate ferredoxin oxidoreductase gamma subunit [EC:1.2.7.1]
Organism
hce  Helicobacter cetorum MIT 00-7128
Pathway
hce00010  Glycolysis / Gluconeogenesis
hce00020  Citrate cycle (TCA cycle)
hce00620  Pyruvate metabolism
hce00640  Propanoate metabolism
hce00650  Butanoate metabolism
hce00680  Methane metabolism
hce01100  Metabolic pathways
hce01120  Microbial metabolism in diverse environments
hce01130  Biosynthesis of antibiotics
hce01200  Carbon metabolism
Module
hce_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hce00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HCW_08665
   00020 Citrate cycle (TCA cycle)
    HCW_08665
   00620 Pyruvate metabolism
    HCW_08665
   00640 Propanoate metabolism
    HCW_08665
   00650 Butanoate metabolism
    HCW_08665
  Energy metabolism
   00680 Methane metabolism
    HCW_08665
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    HCW_08665
Enzymes [BR:hce01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     HCW_08665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR MAF_flag10
Motif
Other DBs
NCBI-ProteinID: AFI04988
UniProt: I0EPW9
Position
1915432..1915992
Genome map
AA seq 186 aa AA seqDB search
MLQIRWHARAGQGAITGAKGLADVISKTGKEVQAFASYGSAKRGAAMMAYNRIDDEPILN
HERFMQPDYVLVIDPGLVFIEDIFADEKEDTTYIITSYLSREELFAKKPELKTRKVFTLD
CLKISMETLKRPIPNTPMLGALMKVSNMLEIEAFKEAFKKVLGKKLAQEVIDANMLAIQR
AYEEVQ
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgctacaaattagatggcatgcacgagctggtcaaggcgcaatcacgggcgctaaagga
ctagctgatgtaatttcaaaaacaggcaaagaggtgcaggcatttgcctcttatggttca
gccaaaagaggtgcggctatgatggcgtataatcgcattgacgatgagcctattttaaat
catgagcgttttatgcaacctgattatgttttggtgattgacccgggattggtatttatt
gaagatatctttgctgatgaaaaagaagataccacttatatcattacaagctatctttca
agagaagagttatttgcaaagaaaccagaacttaaaactcgcaaagtctttacgctagat
tgtttaaaaatctctatggaaactttaaagcgtcctattcctaatactccaatgctaggg
gctttgatgaaagtttctaatatgcttgaaattgaggcgtttaaagaggcgtttaaaaaa
gttttaggcaagaaattggctcaagaagtcattgatgcaaacatgctcgccattcaaaga
gcttatgaagaagttcaataa

DBGET integrated database retrieval system