KEGG   Helicobacter cetorum MIT 00-7128: HCW_08675Help
Entry
HCW_08675         CDS       T02032                                 

Gene name
porA
Definition
(GenBank) pyruvate flavodoxin oxidoreductase subunit alpha
  KO
K00169  pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
hce  Helicobacter cetorum MIT 00-7128
Pathway
hce00010  Glycolysis / Gluconeogenesis
hce00020  Citrate cycle (TCA cycle)
hce00620  Pyruvate metabolism
hce00640  Propanoate metabolism
hce00650  Butanoate metabolism
hce00680  Methane metabolism
hce01100  Metabolic pathways
hce01120  Microbial metabolism in diverse environments
hce01130  Biosynthesis of antibiotics
hce01200  Carbon metabolism
Module
hce_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hce00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HCW_08675 (porA)
   00020 Citrate cycle (TCA cycle)
    HCW_08675 (porA)
   00620 Pyruvate metabolism
    HCW_08675 (porA)
   00640 Propanoate metabolism
    HCW_08675 (porA)
   00650 Butanoate metabolism
    HCW_08675 (porA)
  Energy metabolism
   00680 Methane metabolism
    HCW_08675 (porA)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    HCW_08675 (porA)
Enzymes [BR:hce01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     HCW_08675 (porA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR_N PFOR_II Transketolase_C TPP_enzyme_N
Motif
Other DBs
NCBI-ProteinID: AFI04990
UniProt: I0EPX1
Position
1916408..1917631
Genome map
AA seq 407 aa AA seqDB search
MAKKIELQEVEVWDGNMASSNALRQAQIDVIAAYPITPSTPIVQNYGSFKDNGYIDGEFV
LVESEHAAMSACVGAAAAGGRVSTATSSQGLALMVEVLYQASGMRLPIVLNLVNRALAAP
LNIHGDHSDMYLARDAGWINLSTCNPQEAYDFTLMAFRIAEHQNVRVPTIVNQDGFLCSH
TVQNVRPLSDDIAYKFVGEYQTKHSLLDFDRPVSYGAQAEEEWHYEHKAQLHHAIMSAEK
IIEEVFNDFAKLTGRQYHLTETFQLEDAEVAIFALGTTYESAIVAAKEMRKKGIKAGVAT
VHSLRPFPYERLGQDLKNLKALAILDKSSPAGAMGAMFNEVTSAVYQTKDSKHPVVSNYI
YGLGERDMTIAHLCEIFEEIKEDALKGALTHPTQQFVGLRGPKMSFF
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaaagattgaattacaagaagtagaggtttgggatggcaatatggccagctca
aacgctctaagacaagctcaaattgatgtaattgcagcttacccaattactccatcaact
cctattgtgcaaaactatggttcgtttaaggataatggctatattgatggcgaatttgtt
ttagtagaatcagaacatgcagctatgagtgcgtgcgtaggtgcagctgcagcaggtggg
agagtaagcacagcgactagttctcaaggcttagcgcttatggtagaagtcttatatcaa
gcatctggtatgcgcttacctatcgtattaaacttagttaatcgtgctctagccgctcct
ttaaatatccatggcgaccactctgatatgtatctagctagagatgcaggttggataaat
ctatctacatgcaaccctcaagaagcttatgattttaccttaatggcgtttagaattgcc
gaacatcaaaatgttcgtgtgccaaccattgttaaccaagatggtttcttatgctcacac
actgtgcaaaatgtgcgcccattaagcgatgatattgcatataaatttgtaggtgaatac
caaactaagcactcactcttagactttgatagacctgtaagctatggtgcacaagctgaa
gaagaatggcattatgagcataaagcccaactccaccatgcgattatgagtgctgaaaag
ataattgaagaagtgtttaatgattttgctaaactcacaggcagacaataccacttaaca
gaaactttccaactagaagatgctgaagtggctatttttgcgcttggaaccacttatgaa
tctgctattgtagcggctaaagaaatgcgtaaaaaaggtattaaagctggagtcgccacc
gttcattctttacgccctttcccttatgaaagattaggtcaagatttgaaaaaccttaaa
gctttagccattttagacaagagttctcctgcaggtgctatgggtgcaatgtttaatgaa
gttacttcagcagtatatcaaaccaaagattccaagcaccctgttgtgtctaactatatt
tatggcttaggcgaaagagatatgactatcgcacatctatgtgaaatttttgaagaaatc
aaagaagatgctcttaaaggcgcactcactcatcctacccaacaattcgtaggacttaga
ggccctaaaatgagctttttttaa

DBGET integrated database retrieval system