KEGG   Hahella chejuensis: HCH_00222Help
Entry
HCH_00222         CDS       T00307                                 

Gene name
recD
Definition
exodeoxyribonuclease V subunit alpha (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
hch  Hahella chejuensis
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:hch03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(229223..231160)
Genome map
AA seq 645 aa AA seqDB search
MSIAHLIDAARQSNLLRPLDYYLGQQFAELATAATEEQRELLALTVALTSNALANGHTCL
DLSQYAGRSLWPDSAEEDMRAFIAPSLKLWREALLASGLTQADSDIGDAGPVSPCVLDDR
NCFYLARYFEYERQLAGLLQQRIAHHAAFPPEQVRQALLRFFPSVAAEDRQAIAAAVACR
QGFTAIVGGPGTGKTTTVAKLLGMLGELSEPPLRIALAAPTGKAAARLMESIRNAKLQLG
ERLSHPERIPDTAYTLHRLLKVRGDGKGFVHHAGHPLPVDLLLIDEVSMVDLAMMLRIVE
ALPPHARLMLLGDSEQLASVEAGSVIGDICSQRATAGVSPDMASYLRKIGLTPPYPEEEK
AAPVADCVIRLEVSHRFHARSGIGRLAQAINAGDSEAALQVFRQPEFEDADWENLPPSQL
QSIIQQTAANAYEPCFKADSVETALDAMNRFRILCAVKEGHGGVQEINQWVEAALQRKGL
APRYQLHYHGRPVMVTRNDYSLGLFNGDVGLIWRDPASGQLRAWFPDADGPLRSIPLYRL
PAHETVYAMTIHKSQGSEFDHCVVALPETDQPVLTRELLYTGVTRAKKRISVWGPRHLLI
KSIKRPTQRMSGLARRIWGELQPAGPAVDDKPDEPSGDGVQLDLW
NT seq 1938 nt NT seq  +upstreamnt  +downstreamnt
atgagcatcgcccacttgattgacgccgcccgacaaagcaatctgctgcggccgctggat
tattacctgggtcagcagttcgcagaactggcgaccgcggcgacggaagaacagcgggaa
ctgctggcgctgaccgtcgcgctaacctccaacgccctggctaacggccatacctgtctg
gacctgtcgcaatacgccggccgctcgttgtggccggactcggcggaagaagacatgcgc
gcctttatcgccccttctctcaaattatggcgcgaagcgctgctcgccagcggtttgacc
caggcggattcggatataggcgacgccggcccggtcagtccatgcgtgcttgacgatcgt
aactgcttctatctggcccgatatttcgagtatgagcgccaactcgccgggctcctgcaa
cagcgcatcgcccatcacgccgctttcccgcccgaacaggtgcgtcaggcgctgttgcgc
ttctttccttccgtcgccgcagaggaccgtcaggctatcgccgcagccgtggcctgtcgc
cagggcttcaccgccattgtcggcggtcccggcaccggaaaaaccaccacggtagccaag
ctgttgggcatgctgggagaactgtccgaaccgcctctgcgcattgcgctcgcggcgccg
accggcaaagcggctgcgcgtctgatggagtccatccgtaacgccaaattgcagttggga
gaacgtctgtcacatcccgaacgcattcccgataccgcttacactctgcatcgcctgctc
aaagtccgcggcgacggcaaaggcttcgtacaccacgccggtcatccgcttcctgtggat
ttattattgatagacgaagtgtcgatggtggatctggcgatgatgctgcgtatcgtagag
gcgctgcctcctcacgcccgcctgatgttgctgggcgacagcgaacagcttgcttcggtc
gaggccggcagcgtcattggcgatatctgctcgcaaagagccacagcaggggtcagcccg
gatatggcgagttacctgcgcaaaattggcctgacgcccccctaccccgaagaagagaaa
gccgcacctgttgctgactgcgtcattcgcctggaagtcagtcatcgctttcacgcccgc
agcggcatcggtcgactggcgcaggcgatcaacgccggcgattcggaagccgctctgcag
gtgttcagacagccggagtttgaagacgcggactgggaaaatctgccgccgtcgcaatta
cagtcgatcatccagcagaccgccgccaacgcctatgagccctgcttcaaagcagattcg
gtggaaaccgccctggacgccatgaatcgcttccgcattctctgcgccgtgaaagaaggc
catggcggcgtgcaggaaatcaatcagtgggtggaagcggcgctgcaacgcaaaggcctg
gccccgcgctaccaactgcactaccacggtcgccctgtcatggtgacccgcaacgactat
agtctgggcttgttcaacggcgatgtgggcctgatctggcgcgatccggcatcagggcag
ctaagggcgtggttcccggatgcggacggacctctgcgcagcattcccctataccggctg
cccgcccacgaaaccgtgtacgctatgaccattcacaaaagccagggttccgagtttgat
cattgcgtcgtggcgttgcctgaaaccgaccaaccagtactgacgcgggaactgctgtac
acgggcgtcacccgcgccaagaaacgaatcagcgtatggggaccgcgccatctattgatc
aagtccataaaacgcccaacccaaagaatgtccgggctcgcccgcagaatctggggtgag
cttcagccagcaggccccgcggttgacgataaaccagatgaaccgtctggcgacggcgtg
cagttggacctgtggtga

DBGET integrated database retrieval system