KEGG   Hahella chejuensis: HCH_00269Help
Entry
HCH_00269         CDS       T00307                                 

Definition
glycosidase
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
hch  Hahella chejuensis
Pathway
Starch and sucrose metabolism
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:hch00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(283797..285539)
Genome map
AA seq 580 aa AA seqDB search
MEHASLTQLEQRLMEHVKTLYPDVNALNFIKECLDTFGIQPDAPPPQPHRNPWSQEDVVL
ITYGDTLRRDNEPPLHSLHDFLRTRLRQCISIVHILPFFPYSSDDGFSVMDYTTVVPTLG
DWEDIAAFTREFKVMGDLVINHCSSRSLWFENYKTGQTPGADYFVEAAPDTDLTQVVRPR
TSPLLREVATASGVRHVWCTFSHDQIDLNFRNPQVLLEFLRILRLYLDKGVRWFRLDAVA
FLWKTPGTSCINLPETHEMIRLLRLLIEHRAHDAVIITETNIPNHENLTYFGNANEAHLI
YNFSLPPLLINSLVTGSCEYLKKWLMSMPPAQQGTTYLNFIASHDGVGLRPTEGLLSDWE
LDALVSTMQKFGGKASARTGPDGQPKFYEINISLWNALSGTVQHGPDNLGFARFLCAHAI
MLALEGVPAFYIHSLIGTENDDERVEHTGQLRSINRHIWRGEDLDAVLQGEGHPPKVFAA
MQKLIAIRRRQKAFHPNATQYTLHTGDALFSFWRQSQDRMQSIFAIHNVSDQPQTINLAE
LNLISTDQWFDLISEQIFEDRVGQIILRPYQYIWLTNVRL
NT seq 1743 nt NT seq  +upstreamnt  +downstreamnt
atggagcacgcctcgctcactcaattggagcagcgcctgatggagcacgtcaaaacgctg
tatccagacgtcaatgcgctcaatttcatcaaagaatgtctggatacattcggtatacaa
cccgacgcgccgcctccgcagcctcatcgtaatccctggtcgcaggaggacgtcgtcctc
attacttacggcgacaccctgcgaagggataacgaaccgccgctgcacagtctgcatgat
tttctacgcacccgactgcgccaatgcatcagcatcgtgcatattctgcctttctttccc
tacagctccgacgacggcttcagcgtgatggattacaccaccgtggtccccaccctcggc
gactgggaggatatcgccgccttcactcgcgagttcaaggtgatgggggacctggtcatc
aaccattgctccagtcgctcactctggtttgaaaattacaagacggggcagacgcccggc
gcggattatttcgtggaagccgctcccgataccgacttaacccaggtagtgcgcccgcgc
acctcgccgctgctgcgggaggtcgccaccgcttccggcgtgcgccatgtctggtgcacc
tttagccatgatcagatcgacctgaatttccgcaatccacaggtgctgctggagtttctg
cgcatactgcgtctatatctggacaaaggcgtgcgctggttccgcctggatgccgtggcg
tttctgtggaaaactccggggacctcctgcatcaacctgccggaaacccatgaaatgatc
cgcttgctgcgtctgctgatcgagcatcgcgcccacgatgcggtcatcatcaccgagacc
aacattcccaatcatgagaacctcacttatttcggcaacgccaacgaagcgcatttgatc
tacaacttctccctgccgcctttgctgatcaacagtctggtcaccggtagctgtgaatat
ctgaaaaagtggttgatgagcatgccgccggcgcagcaaggaaccacgtacctgaacttc
atcgcctcccatgacggcgtgggtctgcgccccacagaagggctgctgagcgactgggag
ctggatgcgctggtgtccacgatgcagaagttcggcggcaaggctagcgcgcgcacaggg
cccgacggccagcccaagttctacgaaattaacatcagtctgtggaacgcccttagcggc
actgtgcaacacgggcccgataacttgggcttcgcccgcttcctgtgcgcccacgccatc
atgctggcgctggagggcgtccccgcgttttatattcatagtctgattggaacggaaaac
gatgacgagcgggtggagcataccggccagctccgctctatcaaccgccatatctggcgg
ggggaagacttggacgccgtgctgcagggagagggccaccctccgaaagtgttcgccgcc
atgcaaaagctgatcgccatccgtcgacgccaaaaagccttccatcccaatgcgacccaa
tacaccctgcacaccggcgacgcgctgttctcgttctggcgtcaaagccaggatcgcatg
caaagtattttcgccattcataacgtttcagatcagccgcagaccatcaatctcgctgag
ttaaacttgatttccacggatcagtggttcgatttgatctccgagcagatattcgaggac
cgggtgggccagattatcctgcgtccctatcaatacatctggctgaccaacgtgaggctg
taa

DBGET integrated database retrieval system