KEGG   Hahella chejuensis: HCH_00290Help
Entry
HCH_00290         CDS       T00307                                 

Definition
(GenBank) Uroporphyrinogen-III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
hch  Hahella chejuensis
Pathway
hch00860  Porphyrin and chlorophyll metabolism
hch01100  Metabolic pathways
hch01110  Biosynthesis of secondary metabolites
hch01120  Microbial metabolism in diverse environments
Module
hch_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:hch00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    HCH_00290
Enzymes [BR:hch01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     HCH_00290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4
Motif
Other DBs
NCBI-ProteinID: ABC27203
UniProt: Q2SQ71
Position
complement(309540..310322)
Genome map
AA seq 260 aa AA seqDB search
METTLSQELSGLRVLLTRPQGENDSLRALLEQNSAEVRVLPAIAIEPLPETQAIKDCILD
LDRYTHVICVSKHASRLLLELIDAYWPQAPQGVRWFAIGESSAAPLRSYGLTVNTPEQGC
ASEQLLEHPGLQARNEDEPPMRVLIVKGCGGRELLTETMQERGAHVATLELYERKTLEYD
PNELNEALKQWRPEVVVTLSGETLLHLCQLGQNIGYAWGDTLFVIPSARVATLAQENRLN
YKIAPELSDEALLALLKTAC
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atggaaaccactcttagtcaggagctgagcggcctcagagtgctgttgacccgccctcag
ggagaaaacgattccttgcgcgcgctgttggagcaaaacagcgcggaagttcgggtgttg
ccggccatcgccattgagcccttgcccgaaacgcaagccataaaagactgcatcctcgat
ctggatcgctatactcatgtgatctgcgtgagtaaacatgcatcgcgtctgctgttggaa
ctgatagacgcttactggccgcaagcgccacagggcgtgcgctggttcgctatcggcgaa
agcagcgctgcgccgctacgcagctacggactgacggttaataccccagagcagggctgc
gcctccgagcaattgctggaacaccccggtctgcaggcgcgcaacgaagacgagcccccc
atgcgcgtgttgattgtgaaaggctgcggcggacgcgaattgttgacggaaaccatgcag
gagcgtggcgcgcatgtcgctacattggagttatatgagcgtaaaacgctggaatatgac
cccaatgaattaaacgaagccctcaagcaatggcgtccagaggttgtcgtcaccttatcc
ggcgagactctgctgcacctttgccaactgggccagaatatcggttacgcctggggcgac
acgctgttcgtcatccccagcgccagagtcgccaccctggcgcaggagaaccgtctgaat
tacaaaatcgcgccggagttatccgacgaggccttactggccctcctcaaaacggcatgt
taa

DBGET integrated database retrieval system