KEGG   Hahella chejuensis: HCH_00302Help
Entry
HCH_00302         CDS       T00307                                 

Definition
(GenBank) Response regulator containing a CheY-like receiver domain and a GGDEF domain
  KO
K13590  
diguanylate cyclase [EC:2.7.7.65]
Organism
hch  Hahella chejuensis
Brite
Enzymes [BR:hch01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     HCH_00302
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
322300..324036
Genome map
AA seq 578 aa AA seqDB search
MASENDRWKKKYFDKLDEFEQVESGLKERIHVLERIVVRVSLAAEGVDKDLDRELEALRN
ILRRENGSSRELNQQLDSIEKKVLALDQHKQAISGGVLEALGELIEQLSQQNISREARKQ
LKKYGKQLKNRVEDLRHYPQLLKEFSQLQAAVLQELFSDSDGRKDKKEGFLSRLFANREG
GESVVQEELEEDIEAPPPQSQDAEESRYALEVGQDAAASTLDGGNFEPGFSAIADHVCIS
LNHLIDQLVLPPNMLGDSEKLKNKISGGLNWYELAPTLDDVAALAIAAVGRGQREFESFL
KALDERLASIQNFLQGSQANVQESRDNNAELEKSVREQVTSMQENVRGATDIDSLKCSVQ
HNLDTLISSIDRFMHKEADREARLSEEVELLHHRLRELESESGEVRERLEIERARALTDA
LTALPNREAYENRVRDEFERWRRYGNPLTLVVADIDRFKEVNDKFGHLAGDKVIQLIGKE
VSRRIRKTDFIARYGGEEFVVLLPETPASIAAEVMDKTREMISRLPFHFRNEKVRITMSF
GVCEFHGDATVQGVFEKADQALYKAKRSGRNQVQIAGV
NT seq 1737 nt NT seq  +upstreamnt  +downstreamnt
atggcttctgaaaacgatcgctggaaaaaaaagtatttcgacaaactggatgagttcgag
caggtggagtccggtcttaaagagcgcattcatgtactggagcgcatagttgtccgcgtc
agcttggcggcggaaggcgtggacaaagatctggaccgggagctggaagcgctacgcaat
attctgagaagggaaaacggaagctcccgtgaactgaaccaacaactggatagtatagaa
aaaaaggtgctggcgctggatcagcacaagcaggcgatttcaggcggcgtgctggaggcc
ctgggagaattaatagagcagttgtcacaacaaaatatttcacgagaagcgcgtaagcag
ttaaagaaatatggcaaacaactcaaaaatcgggtggaggatctacgacattacccgcag
ctattgaaggagttttctcagctccaagcggcggtgctacaggagctgttcagtgattca
gatgggcgtaaggataagaaagagggctttttaagtcggttattcgccaatcgcgaaggc
ggcgagagcgtcgtccaagaggagttggaggaagatattgaagccccgccgccgcaatct
caggatgctgaagagagtcgctatgcgttggaagtaggtcaggatgcagcggcttccact
ttggacggcggaaacttcgaaccaggcttttctgcaattgccgatcatgtgtgcatatct
ttgaatcatctgattgatcagctggtattgccgccaaacatgctgggggattctgagaaa
ctaaagaataaaatcagcggaggcctgaactggtatgagctggctccaaccctggacgat
gtggctgcgctggcgattgcggcggtcggccgggggcaacgagagtttgagagtttcctg
aaggcattggatgaacgcttggcgagtattcagaattttctccagggaagccaagccaat
gttcaggagtcgcgagacaataatgcggagctggaaaaaagcgtgcgtgagcaagtgact
tccatgcaggagaatgtgcggggagcgacggatatagattcgttgaaatgctcagtgcaa
cacaatctggacactctgatatcttccatcgatcgcttcatgcataaagaggctgatcga
gaagcgcgtcttagcgaagaagttgaattgctgcatcaccgcctgcgtgaattggagagt
gaatccggcgaagtgcgcgaacggttggagatagaacgcgccagggcgcttacagacgct
cttacagcgcttccaaacagggaagcctatgagaaccgcgtgcgcgatgagtttgagcgc
tggcggcgttacggcaaccctctgacgctggtggtggcggacatcgaccgttttaaagag
gtgaatgataagttcgggcatctggcgggagacaaagttattcaactgataggcaaggaa
gtctcgcgcagaatacgtaaaacggattttatcgcccgttatggcggtgaagagtttgtc
gtactattgccggagaccccggccagcattgctgcggaagtaatggataagacccgggaa
atgatttcccggctaccctttcattttcgtaatgaaaaagtccgcattaccatgtcattt
ggcgtttgcgagtttcacggtgacgcaacagtgcagggggtatttgaaaaggcggatcag
gcgctttacaaagccaagcgcagtggccgcaatcaggtgcagattgcgggggtatga

DBGET integrated database retrieval system