KEGG   Hahella chejuensis: HCH_00302Help
Entry
HCH_00302         CDS       T00307                                 

Definition
response regulator
Orthology
K13590  
diguanylate cyclase
Organism
hch  Hahella chejuensis
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
322300..324036
Genome map
AA seq 578 aa AA seqDB search
MASENDRWKKKYFDKLDEFEQVESGLKERIHVLERIVVRVSLAAEGVDKDLDRELEALRN
ILRRENGSSRELNQQLDSIEKKVLALDQHKQAISGGVLEALGELIEQLSQQNISREARKQ
LKKYGKQLKNRVEDLRHYPQLLKEFSQLQAAVLQELFSDSDGRKDKKEGFLSRLFANREG
GESVVQEELEEDIEAPPPQSQDAEESRYALEVGQDAAASTLDGGNFEPGFSAIADHVCIS
LNHLIDQLVLPPNMLGDSEKLKNKISGGLNWYELAPTLDDVAALAIAAVGRGQREFESFL
KALDERLASIQNFLQGSQANVQESRDNNAELEKSVREQVTSMQENVRGATDIDSLKCSVQ
HNLDTLISSIDRFMHKEADREARLSEEVELLHHRLRELESESGEVRERLEIERARALTDA
LTALPNREAYENRVRDEFERWRRYGNPLTLVVADIDRFKEVNDKFGHLAGDKVIQLIGKE
VSRRIRKTDFIARYGGEEFVVLLPETPASIAAEVMDKTREMISRLPFHFRNEKVRITMSF
GVCEFHGDATVQGVFEKADQALYKAKRSGRNQVQIAGV
NT seq 1737 nt NT seq  +upstreamnt  +downstreamnt
atggcttctgaaaacgatcgctggaaaaaaaagtatttcgacaaactggatgagttcgag
caggtggagtccggtcttaaagagcgcattcatgtactggagcgcatagttgtccgcgtc
agcttggcggcggaaggcgtggacaaagatctggaccgggagctggaagcgctacgcaat
attctgagaagggaaaacggaagctcccgtgaactgaaccaacaactggatagtatagaa
aaaaaggtgctggcgctggatcagcacaagcaggcgatttcaggcggcgtgctggaggcc
ctgggagaattaatagagcagttgtcacaacaaaatatttcacgagaagcgcgtaagcag
ttaaagaaatatggcaaacaactcaaaaatcgggtggaggatctacgacattacccgcag
ctattgaaggagttttctcagctccaagcggcggtgctacaggagctgttcagtgattca
gatgggcgtaaggataagaaagagggctttttaagtcggttattcgccaatcgcgaaggc
ggcgagagcgtcgtccaagaggagttggaggaagatattgaagccccgccgccgcaatct
caggatgctgaagagagtcgctatgcgttggaagtaggtcaggatgcagcggcttccact
ttggacggcggaaacttcgaaccaggcttttctgcaattgccgatcatgtgtgcatatct
ttgaatcatctgattgatcagctggtattgccgccaaacatgctgggggattctgagaaa
ctaaagaataaaatcagcggaggcctgaactggtatgagctggctccaaccctggacgat
gtggctgcgctggcgattgcggcggtcggccgggggcaacgagagtttgagagtttcctg
aaggcattggatgaacgcttggcgagtattcagaattttctccagggaagccaagccaat
gttcaggagtcgcgagacaataatgcggagctggaaaaaagcgtgcgtgagcaagtgact
tccatgcaggagaatgtgcggggagcgacggatatagattcgttgaaatgctcagtgcaa
cacaatctggacactctgatatcttccatcgatcgcttcatgcataaagaggctgatcga
gaagcgcgtcttagcgaagaagttgaattgctgcatcaccgcctgcgtgaattggagagt
gaatccggcgaagtgcgcgaacggttggagatagaacgcgccagggcgcttacagacgct
cttacagcgcttccaaacagggaagcctatgagaaccgcgtgcgcgatgagtttgagcgc
tggcggcgttacggcaaccctctgacgctggtggtggcggacatcgaccgttttaaagag
gtgaatgataagttcgggcatctggcgggagacaaagttattcaactgataggcaaggaa
gtctcgcgcagaatacgtaaaacggattttatcgcccgttatggcggtgaagagtttgtc
gtactattgccggagaccccggccagcattgctgcggaagtaatggataagacccgggaa
atgatttcccggctaccctttcattttcgtaatgaaaaagtccgcattaccatgtcattt
ggcgtttgcgagtttcacggtgacgcaacagtgcagggggtatttgaaaaggcggatcag
gcgctttacaaagccaagcgcagtggccgcaatcaggtgcagattgcgggggtatga

DBGET integrated database retrieval system