KEGG   Hahella chejuensis: HCH_00434Help
Entry
HCH_00434         CDS       T00307                                 

Gene name
glk
Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
hch  Hahella chejuensis
Pathway
hch00010  Glycolysis / Gluconeogenesis
hch00052  Galactose metabolism
hch00500  Starch and sucrose metabolism
hch00520  Amino sugar and nucleotide sugar metabolism
hch00521  Streptomycin biosynthesis
hch01100  Metabolic pathways
hch01110  Biosynthesis of secondary metabolites
hch01120  Microbial metabolism in diverse environments
hch01130  Biosynthesis of antibiotics
hch01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hch00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HCH_00434 (glk)
   00052 Galactose metabolism
    HCH_00434 (glk)
   00500 Starch and sucrose metabolism
    HCH_00434 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    HCH_00434 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    HCH_00434 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    HCH_00434 (glk)
Enzymes [BR:hch01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     HCH_00434 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase
Motif
Other DBs
NCBI-ProteinID: ABC27344
UniProt: Q2SPT0
Position
444868..445836
Genome map
AA seq 322 aa AA seqDB search
MSKAQYALVGDIGGTNARFALVARDSFELEHIQVLPCNDYANLDEAVRDYLAHHPEAEVH
EACMAFACPVHGDTIKMTNNHWTFNKADMQARLGFDTFKYVNDFTAMALGTLHVADERLQ
KVGGGEGKDGAARLVIGPGTGLGVSGLVRTMTDWAPLSTEGGHVDFAPTDEVEISVLRIL
KERFGRVSVERILCGEGLLNLYRSLCEIDGVEPAHTQPSQVTEAALANSDVIAHKTLKLF
CAIFGRVTGNAALTLGALGGVYVCGGIIPRFIEFFRDSDFRQCFEDKGRMRDYLGGIPVY
VVTETYTGLLGAAEALKNQEVH
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaagcgcaatacgccctggtgggcgatattggcggcaccaatgcgcgtttcgcg
ctggtggcccgggatagtttcgagctggagcacatccaggtgcttccttgtaatgattac
gccaatctggatgaagcggtgcgggattacctggcccatcatccagaagctgaagttcat
gaagcctgtatggcgttcgcctgtccggtgcacggcgacactatcaaaatgaccaacaat
cactggactttcaacaaggcggacatgcaggcccgtttgggctttgatacgttcaagtac
gttaatgatttcaccgctatggcccttggcactctgcacgtggcggacgagcgcttgcag
aaagtcggcggcggtgagggcaaagacggcgcagccagattggtgattggtcctggtaca
ggattgggcgtgtctggtctcgtgcgcaccatgacggattgggctccgttgtccacggaa
ggcggtcatgttgattttgcgccgacggatgaagtggaaatcagtgtgctgcgaatcctg
aaagagcgtttcgggcgcgtatccgttgagcggattctgtgcggcgaaggcttgttgaac
ctgtatcgcagtctatgcgagatcgatggcgtagagccggcgcatacgcagccttcgcaa
gtcacggaagcggcgctggcgaacagtgacgttatcgctcataagacattaaaactgttc
tgcgccattttcggacgcgtaacgggcaatgctgcgctgactttgggcgcgctcggcggc
gtttacgtgtgtggaggcattattccccgctttattgagtttttccgcgacagcgatttc
cgccagtgttttgaagacaaaggccggatgcgcgattatctcggcggcattcctgtttat
gtggtgacggaaacttacaccgggctgctcggcgcagcggaagcattgaaaaaccaagag
gtgcattag

DBGET integrated database retrieval system