KEGG   Hahella chejuensis: HCH_00505Help
Entry
HCH_00505         CDS       T00307                                 

Definition
cytochrome c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
hch  Hahella chejuensis
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(516884..518239)
Genome map
AA seq 451 aa AA seqDB search
MTRSIKNNLLSRSIALTVLTSAQVFAGSLPSPVIDSDYYDNGDPAPAKYELGRMLFFDKI
MSGNRNISCATCHNPLLATTDGLSLGIGEGGRFIGPYRTTGSGDDAVPGRIGRHAPHLYN
LGAREFIHLNWQGIMEGNADKPSEISIPAGPEKPDGLDNVLAGQALFPIANINEMIGQRG
ENEIADSVRPGNGRFRPIWEGYLKRIRAIPEYVELFQAAYPNISLPDDIKIAHYANAIAA
FETRAFRADNSRFDQYLRGGVDALSPKEVEGMNLFYGAAGCDSCHSGKFQTDHSFHNIAM
PQIGPGPEARMPLEDRGRTEASREQSDFAKFKTPSLRNVAHTAPYGHSGAFATLEGVVRH
HLNALESLDNYDTSQALMPSRSDLDEIDFQGYEDVSLRDKIAQNNELRPNPLSDAEVSAL
IAFLHTLTDTDSLNLRKLIPSQVPSGIAVSD
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
gtgactcgttccataaaaaacaatctcttaagtcgttctatcgcacttactgtcttaacc
agcgcacaagtcttcgcagggtctttaccatcgccagtgatcgattcggattactatgat
aatggcgatccggctccggctaaatatgagttgggacgcatgctcttcttcgacaagatt
atgagcggcaaccgcaatatttcctgcgccacgtgccataacccattgctggcgaccact
gacggcctgtctctgggcatcggcgaaggcgggcgttttatcgggccttatcgcaccaca
ggttccggcgacgacgccgtacccggtcgtattgggagacatgccccccatctttataac
ctgggcgcgcgggagttcattcatctcaattggcaaggcatcatggaaggcaatgcggac
aagccaagcgaaatcagtattcctgccggcccggaaaagccagacgggttggataacgta
ctggccgggcaggcgctgttccccatcgccaacatcaatgagatgatcgggcaacgcggc
gagaatgaaatcgccgactccgtccgccccggcaatggccgcttccgtcccatttgggag
ggctatctgaaacgcattcgcgccattcccgaatatgtcgaattatttcaggctgcttat
cccaacatcagtctgcccgacgatatcaagatcgctcattatgcaaacgccatcgccgcc
tttgaaacccgcgcctttcgcgccgacaacagccgttttgatcagtatctgcgaggcggt
gtcgacgcactcagtccgaaggaagtggaaggtatgaatttattctacggcgcggcgggt
tgcgacagctgccatagcggtaaattccagactgaccacagtttccacaacatcgccatg
ccgcagatcggccccgggccggaggcgcgtatgccactagaggatcgcggtcggacggaa
gccagtcgtgagcagagcgacttcgccaagttcaaaacgccctcgctgcgtaacgtcgcc
catactgctccgtacggccacagcggggcttttgctacattggaaggcgtcgtcaggcac
cacctgaatgcgctggagtcattggacaattacgacacatcgcaagccttgatgccctct
cgcagcgatctggatgagattgactttcaggggtatgaggatgtttcgttacgggacaaa
atcgcccagaacaacgaactgcgccccaacccgttatcggacgcggaagtcagcgccttg
atcgccttcctgcatacgttgacggacacggacagtcttaatctccgtaaactgattccc
agccaggttccaagtggcattgcggtcagcgattga

DBGET integrated database retrieval system