KEGG   Hahella chejuensis: HCH_01004Help
Entry
HCH_01004         CDS       T00307                                 

Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
hch  Hahella chejuensis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hch00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    HCH_01004
Enzymes [BR:hch01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     HCH_01004
Exosome [BR:hch04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   HCH_01004
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1005772..1006779
Genome map
AA seq 335 aa AA seqDB search
MAFTPRQYPAVRMRRMRYDSFSRRLMRETTLTVDDLIYPMFVLPGNEKAQKIDSMPGIER
VNVEDLLREAEELVGLGIPAIALFPVIPAAGKSENAAEAYNPEGLVPTAVRALKSRFPEL
GVITDVALDPYTTHGQDGLINDKGYVLNDATVEVLVKQGLTHAEAGADVVAPSDMMDGRI
GELRGALEKQSYINTRILAYSAKYASAYYGPFRDAVGSAANLGKSDKYSYQMDPGNSDEA
MQEIALDLAEGADMVMVKPGMPYLDIVRRAKSEFQVPTFVYQVSGEYAMHMAAAQQGWLN
ETAVMMESLTCIKRAGSDGILTYFAKKAAQHLKQT
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
gtggcatttaccccccgtcaatatccggctgtgcgcatgagacgcatgcgttacgatagc
ttttcccgtcgactgatgcgcgaaaccacgcttaccgttgatgatttgatttacccgatg
ttcgttcttcccggtaatgagaaggcgcagaagattgattctatgccaggaattgagcgg
gtcaatgtcgaggacttgctgcgtgaggcggaagagctggtgggactgggtattcccgct
attgcattgtttcctgtgattcctgcggcgggtaaaagcgagaatgcggcggaggcctat
aatcccgaagggctggtcccgacggcggtgcgggcgcttaaaagccgttttcctgagttg
ggtgtgattaccgatgtcgccctcgatccatacaccacccatgggcaggatggcctgatt
aacgataaaggttatgtgctcaatgacgcaacggtggaagtgcttgtcaaacaaggcctc
acccatgctgaagcaggcgcggatgttgtagctccctcggatatgatggacggccgcatt
ggcgagttgcgcggcgccctggaaaaacaaagctatattaatactaggatactcgcttat
tcggcgaagtatgcgtccgcttattacgggccattccgcgacgcggtcggctcggcggcc
aatctggggaaaagcgataaatacagttatcagatggaccccggcaacagcgatgaggcc
atgcaggaaatcgcgctggatctggccgaaggcgctgacatggtcatggtcaagcctggt
atgccctacctcgatatagtgcgtcgagccaaatctgagtttcaggttccgacatttgta
tatcaggtcagcggcgaatacgccatgcatatggcggcggcccagcagggttggttgaat
gagaccgcggtgatgatggagtcgctgacgtgcatcaagcgcgcaggctcagatgggatt
ttgacctatttcgccaagaaggcggcgcaacatttaaaacagacataa

DBGET integrated database retrieval system