KEGG   Hahella chejuensis: HCH_01025Help
Entry
HCH_01025         CDS       T00307                                 

Definition
phosphomannomutase
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
hch  Hahella chejuensis
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hch00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HCH_01025
   00030 Pentose phosphate pathway
    HCH_01025
   00051 Fructose and mannose metabolism
    HCH_01025
   00052 Galactose metabolism
    HCH_01025
   00500 Starch and sucrose metabolism
    HCH_01025
   00520 Amino sugar and nucleotide sugar metabolism
    HCH_01025
  Nucleotide metabolism
   00230 Purine metabolism
    HCH_01025
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    HCH_01025
Enzymes [BR:hch01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     HCH_01025
    5.4.2.8  phosphomannomutase
     HCH_01025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1020804..1023452
Genome map
AA seq 882 aa AA seqDB search
MKPMKKKQAETNGKANGNGAKKPKPAPANNSKQTETKGLAGPGLFTGLSAVLAALCVVIT
AFVLKSTVLQPLVDEVNAATQKSNLDAAVSVINNRLKFIEDQVAVLAGSVDAARFVDDQV
RAQVTGIATKTLPAAVRAVAFPKGRGVRDTESPVPVSFASLDMVRNVEQGKPVRLEAFVS
NEKWFIQVVKPVQTDSNVIVGTVLVMFSTEILEPTWRQTGGGKYQLLQSAGGQQRVVIEH
GQGSGDKLVGSTALPQWQVAYYPNESARFSYSDQTLWVVALAIALLAAGLAAAPVFLLTK
KVRKDISTVTAFGQACIMGEKPSSPKISLLAFHSMVVLLDQARQIAVKRSIPTKSKATAA
ETETAPAKKTSQPAKKEEAAPLFQNDDALDISMLGDDDDLLGLHDDEPASDFGEGASMEV
NESQVVNVSDTIFRAYDIRGVVNDTLDAKVMYEIGRALGSEARQRNVTDMCLGYDGRESS
PALAKALAQGIMATGVNVINVGLVPTPVLYFAAHHTQTLSGAMVTGSHNPAEYNGVKMML
AGDTLAQAEIQKLLQRIRTQNYVKGQGELRNQDIRQNYIDAIVNDIAVAAPLKVVLDAGN
GVAGDIAPKLIEELGCEVTPLFCEVDGNFPNHHPDPGKPENLQALIAKVKEVGADIGVAF
DGDGDRIGVVTAKGKIIWPDRLLMLFAKDVVSRNPGADVIFDVKCSRRLNSLISSYGGRP
IMWRTGHSLIKAKMKETGALLAGEMSGHIFFKERWFGFDDGIYSAARLLEILGIDERNAD
AVFDEFPEDVSTPEINVAVSDSSKFMVMEKLSQNASWGDGNVSSIDGVRVEYADGWGLCR
ASNTTPVLVMRFEAESQEALARIQKVFRDQLLAVDPSLSIPF
NT seq 2649 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccgatgaaaaagaagcaggcggagactaacggcaaagcgaacggtaatggcgca
aagaagcccaaaccggccccagcgaacaacagcaaacagacggaaaccaaagggcttgcc
ggtccgggactttttaccggattgagcgcggtcctggcggcgctttgtgtcgtcatcacc
gcttttgtattgaagtctacggtgttgcagcctttggtggatgaagtaaacgccgcaact
cagaagagtaatctggacgcggcggtatcggtaattaacaaccgtctgaaatttatcgag
gaccaggtcgcagtgttggcgggcagtgtggacgccgccaggtttgtggatgatcaggtg
cgtgctcaagttaccggtatcgccactaaaactttgcctgctgccgtgcgagcggtcgcg
ttcccgaagggaagaggcgtacgtgacacagaatctcctgtgccggtgagcttcgccagc
ctggatatggtgcgcaatgtagaacagggcaagccggtgcgtctggaagccttcgtatct
aacgagaagtggtttattcaagtcgtaaagccggtgcaaacagactctaacgttatagtc
ggcaccgtattggtgatgttcagcacagagattcttgagcctacttggcgccagaccggc
ggtggaaagtatcaactgttacagtccgctggcggacagcagcgagtagtgatagaacat
ggccaaggctccggcgacaagcttgtagggagcactgctttgccgcaatggcaagtggcg
tattaccccaacgagtccgcccgcttttcgtatagcgaccagacgctgtgggtcgtcgcg
ctggctatcgctttattggcggcgggattggcggctgcgcctgtgtttttgcttactaag
aaggtgcgcaaggatatttcgacggttacggcgttcggccaggcctgcattatgggggaa
aagccaagctcgccgaagatctccctgctggcctttcactccatggtggtgttgctggat
caggcgcgccagatcgctgtgaagcgttctatccccacaaaatccaaagccacagctgct
gagacagagacggccccggccaagaagacgtctcagccagccaaaaaggaggaggctgcg
ccgctatttcaaaatgatgatgcattggacatcagcatgttgggagacgacgacgacctt
ttggggctgcatgatgacgagccggcttccgactttggcgagggggcgtcaatggaagtc
aatgaatcccaggtggtgaatgtctccgatacaatcttccgtgcctacgatattcgcggg
gttgtgaacgacaccttagacgccaaagtgatgtatgaaatcgggcgggcgctcggatcg
gaggcgcgccagagaaatgtgacggatatgtgcttgggctatgacggtcgcgaatccagc
ccagccctggctaaggcgctggcgcaagggattatggccactggcgttaatgtcattaat
gtgggacttgtgcccacgccggtgctttattttgccgcgcaccatactcaaacgctttct
ggcgcaatggtgaccggcagccataatcccgcggaatataacggcgttaagatgatgctg
gcgggagatacgctggcgcaggcggagatccagaagctgctgcagcggatacgtacgcag
aattatgtcaaaggacagggcgagctgagaaatcaggacatccgccagaattatattgac
gccattgtcaatgatattgctgtcgctgcgccgctcaaggtggtgttggacgcaggcaac
ggcgtcgctggcgatattgcgcccaagttgattgaagaactgggctgcgaagtaacgccc
ctgttctgtgaagtggatggtaacttcccgaaccatcatcctgatcctggcaagccagaa
aatctacaagccctcattgccaaggtcaaagaagtaggcgccgatattggtgtggcgttt
gacggtgatggcgaccgcataggcgttgtcacggcgaaaggcaagattatctggccggat
cgtctattgatgctgttcgccaaggatgtggtttcgcgtaaccctggcgctgacgttatt
ttcgatgtgaaatgcagccgccgattgaactctcttatttccagttatggcggtcgtcca
atcatgtggcgcactgggcactcgctgatcaaggcgaagatgaaagagactggcgcttta
ttggcgggcgagatgagcggccatattttcttcaaggagcgttggttcggttttgacgat
ggcatatacagcgcggctcgcctgctggaaattctgggtattgacgaacgtaacgcagac
gccgtgtttgacgagtttccagaggatgtttccacaccggaaatcaatgttgcggttagc
gatagcagcaagttcatggttatggaaaaactgtctcaaaacgcatcctggggtgatggc
aatgtgtccagcatcgatggggtgagagttgagtacgccgatggctggggtttatgccgg
gcttccaatactacgccggtgttggtgatgcgctttgaagcggagagtcaggaagcattg
gcgcgcattcaaaaggttttccgcgaccagttgctggccgtggacccttctttgtcgatt
cctttttaa

DBGET integrated database retrieval system