KEGG   Hahella chejuensis: HCH_01191Help
Entry
HCH_01191         CDS       T00307                                 

Definition
phosphodiesterase/alkaline phosphatase D
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
hch  Hahella chejuensis
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:hch00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:hch00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:hch02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1188019..1189764)
Genome map
AA seq 581 aa AA seqDB search
MKRISRREFIRVTAAGMGALAISTGLAGCSSDDDANSTYQVTFSHGVASGDPLSDRVIIW
TRALPDDTGAEVSVSWEVADDAGFSNLLHNGTTQTSAAQDFTVKVDVLNLQPGATYYYRF
TANGSASPAGATKTLPTVSPEQVKFAVFSCANYPAGHFNVYAEAALHDDLDAVIHLGDYI
YEYGAGGYATEDAAAIGRTLPDDNANEILSLADYRKRYALYRSDANLQALHRKTPFITVW
DDHEIADDTWKSGAKNHNDGEGEFEDRKIAALQAYFEWMPIRPVVDDNQEIIYRQFQFGD
LVSLYMLDTRVLARDKQLDYLDYLDPVSGAFNAPQFSADVSDANRTLLGAEQRNWLQNTM
AASNATWQVLGQQILMGRMLLPAELLTQLLNPDPNTILPAFAELANIKGRILMGDPSVTD
AERVRVETVLPYNLDAWDGYAAEREVLFETAKAMNKNLVALAGDTHNAWASDLKTLSGDH
VGVEFATASVSSPGLETYLSLPDDEATIAQTELGVTTLVSDLRYLNVNQRGYLLTTFTAD
EARADWRFVDTVKSPTYQLAAARSVSYKTLPGSNNRKLIEV
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagaataagcagacgcgaatttatcagagtcaccgccgccggcatgggggcgttg
gcgatatccactggtctggcggggtgcagctccgatgacgacgccaattcaacctatcag
gtgaccttcagtcacggcgtcgccagcggcgatccgctcagcgaccgcgtgatcatctgg
acccgcgccctccccgacgataccggcgctgaagtgtcggtatcctgggaggtggcggac
gacgcaggcttcagcaacctgctgcataacggaaccacgcagacatccgctgcgcaggac
ttcaccgtcaaggtggacgtgctgaatctgcaacccggagcgacttattactaccgtttc
accgcaaacggctcggcctctcccgcaggcgccaccaaaaccctaccgacggtcagcccg
gaacaggtcaagttcgccgttttctcctgcgccaattatcccgccggacacttcaacgta
tacgcggaagcagccttgcatgacgacctggacgcggtcatacatctgggagactacatc
tacgaatacggcgccggcggttatgcgacggaagacgccgccgccatcggacgcacgttg
ccggacgacaacgccaacgagatcctctcgcttgccgattaccgcaagcgctatgcgctg
tatcgcagcgacgccaatctacaggcgctgcaccgcaaaaccccgttcatcaccgtctgg
gatgaccacgagattgctgacgacacctggaagtccggcgctaaaaaccacaatgacggc
gaaggcgagtttgaagaccgcaaaatagcggcgctgcaggcttacttcgaatggatgccg
attcggccggttgtggatgacaatcaggagatcatttatcgccagttccagttcggcgat
ctggtgtccctctacatgctcgacacccgcgtgctcgcccgcgacaaacaactggattat
ctcgattatctggacccggtcagcggcgccttcaacgcgcctcagttcagcgcagacgtc
agcgacgccaaccgtacgctgctgggcgcggaacagcgaaactggctgcaaaacaccatg
gctgcgtccaacgccacctggcaggtgctgggacagcaaatattgatggggcgcatgctg
ctgcctgcggaactactgacccagctgctgaatccagatcccaacaccatcctgcctgca
ttcgccgagctggcgaacatcaagggccgtatcctgatgggcgatcccagcgtgacggat
gccgagcgcgtaagggtagagaccgtactgccttacaacctggacgcctgggacggctat
gcagcagaacgggaagtgttgttcgagacggcgaaggccatgaacaagaatctggtggcg
ctggcgggagacacccacaacgcctgggccagcgacctgaaaaccctgtccggcgaccat
gtcggcgtggagttcgccaccgcgtcagtgtcctctcccggtctggaaacctacctttcc
ctgccggatgacgaggccacgattgcccagaccgagttgggcgtgaccacgctggtgagc
gacttgcgatacctgaacgtcaatcaacgcggctacctgctgaccacgttcaccgcagac
gaagccagggcggactggcgtttcgtcgacaccgtgaagagccccacctaccaactggcc
gccgcgcgttccgtcagttataaaacgctgccggggtcgaataaccgcaagttgattgaa
gtttga

DBGET integrated database retrieval system