KEGG   Hahella chejuensis: HCH_01235Help
Entry
HCH_01235         CDS       T00307                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
hch  Hahella chejuensis
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:hch00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HCH_01235 (tpiA)
   01230 Biosynthesis of amino acids
    HCH_01235 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HCH_01235 (tpiA)
   00051 Fructose and mannose metabolism
    HCH_01235 (tpiA)
   00562 Inositol phosphate metabolism
    HCH_01235 (tpiA)
Enzymes [BR:hch01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     HCH_01235 (tpiA)
Exosome [BR:hch04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   HCH_01235 (tpiA)
  Exosomal proteins of bladder cancer cells
   HCH_01235 (tpiA)
  Exosomal proteins of melanoma cells
   HCH_01235 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1248200..1248946
Genome map
AA seq 248 aa AA seqDB search
MRKKLIAGNWKSNGSLERNKALLEGIVNAKALGSVDVVVCPPFPYLQSVESAVSDSMIEL
GSQNCSATEDGAYTGEVSAKMCADMKCSWVILGHSERRALYAENDEVIACKVKRAVESGL
APILCVGETLADRESGRAEEVTLKQLDAVFMSVQPDDSWVVAYEPVWAIGTGKTASPEDA
QSMHKALRNNIRKHFPQIADKIRILYGGSVKSSNAKELFSMPDVDGALVGGASLVSEEFV
SIIEAAVE
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgcgaaaaaaactgatcgccggaaactggaagtctaatggaagtcttgagcgtaataag
gctctattagaaggtatagttaacgctaaggcgttaggctcagttgatgtggtggtttgt
cctccatttccgtatcttcaaagtgttgagagtgcagtttctgattccatgattgagttg
gggtctcaaaattgctccgccactgaagatggcgcatataccggtgaggttagcgctaaa
atgtgcgctgatatgaagtgttcctgggtgatacttgggcattctgagcgcagggcgtta
tacgccgagaacgatgaagttatcgcttgtaaagttaagcgtgcagttgagtcgggattg
gctccgatactgtgtgtgggcgaaacgctggcggatcgcgagtcaggccgagctgaagaa
gttacgcttaagcagcttgatgctgtgtttatgtctgtccaacctgatgattcgtgggtt
gtggcgtacgagccggtatgggctataggcacgggtaaaactgcttcgccagaggatgcg
cagagtatgcataaagccttacggaacaatattcgtaagcattttccgcagatagcggat
aaaattagaattttgtatggcggcagcgttaagtcgtcaaacgcgaaagaactgttctca
atgccggatgtagatggggctctagttggtggcgcctcgttagtctcggaagaatttgtc
tctattatcgaggctgcggtagagtaa

DBGET integrated database retrieval system