KEGG   Hahella chejuensis: HCH_01539Help
Entry
HCH_01539         CDS       T00307                                 

Gene name
pldB
Definition
lysophospholipase (EC:3.1.1.5)
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
hch  Hahella chejuensis
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:hch00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    HCH_01539 (pldB)
Enzymes [BR:hch01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     HCH_01539 (pldB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1544710..1545750
Genome map
AA seq 346 aa AA seqDB search
MTPFWDRELLRKQLRPISFKDAPHLTEIEKHYCSYYRIDKETRITGVAHRLGYFEAIGYR
LACHMYTPPRPRGTVFVFHGYFDHVGLFGHLVEHLLRDGYAVVAYDLPGHGLSSGETVSI
KNFAQYQSILEACLMLCDGHMPKPWMSVGQSTGGAVLIEYLFSNRFTPESSPFLHWAFLA
PLVRPQGWRSVIMLHTLFGPFIRTWRRVFMANSNDPEFIKFLKDKDPLQSRAVSIDWVGA
LRRWVKRIESTDPLEQPVTIVQGKEDTTVDWRHNIPQLQRLLPNAEVQYLETGRHQLVNE
SPEIRARVFGWISEAFDRAIADQRSASVKKNETRITANSDKSGDRE
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgacgccattctgggacagagaactcctgcgcaagcaactgcgtccgatttcatttaaa
gacgcgccccatctgactgagatagaaaaacactactgcagttactatcgcatcgataaa
gaaacccgcataaccggcgtggcgcatcgtctgggttactttgaggctattggttatcgg
ctggcctgtcatatgtatacgcctccccggccgcgcggtacggtatttgtgtttcacggc
tactttgatcatgtgggactgttcgggcacttggttgaacatttgttgcgcgatggctac
gcggtggtcgcatacgacttacccggtcacggactgtccagcggagagaccgtttcgatc
aagaactttgctcaatatcagtctattttggaagcctgtctgatgctgtgcgacggccat
atgccgaaaccctggatgtccgtggggcaaagcacgggcggggcggttttaatagagtat
ctgttcagtaaccggtttacgcccgaaagcagcccattcctgcattgggcgtttttggcg
ccattggtgcgtccgcaggggtggcgctctgtgataatgctgcataccttgtttgggcct
tttatccgtacttggcgtcgggtatttatggccaactccaacgaccccgaatttattaaa
tttctcaaagacaaagatcctttgcagtcgagggcggtgtccattgactgggttggcgcg
ctgcgacggtgggtaaaacgtattgaaagcacggaccctctggagcaacctgtcaccatc
gtgcaaggtaaggaagacactaccgtggactggcgccataatattccgcaattacagcgc
ctgttgccaaatgcggaagtgcaatatctggagactggacgtcatcaactggtaaacgaa
tcgccagagatccgcgcaagggtctttggctggatcagtgaagcttttgacagagctatc
gctgatcagcgttcagcttctgttaagaaaaatgaaactagaattaccgccaactctgat
aaatctggagatagagaatga

  All links  
No link information was found.   
DBGET integrated database retrieval system