KEGG   Hahella chejuensis: HCH_01597Help
Entry
HCH_01597         CDS       T00307                                 

Definition
(GenBank) Sterol desaturase
  KO
K00227  Delta7-sterol 5-desaturase [EC:1.14.19.20]
Organism
hch  Hahella chejuensis
Pathway
hch00100  Steroid biosynthesis
hch01100  Metabolic pathways
hch01110  Biosynthesis of secondary metabolites
hch01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:hch00001]
 Metabolism
  Lipid metabolism
   00100 Steroid biosynthesis
    HCH_01597
Enzymes [BR:hch01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.20  Delta7-sterol 5(6)-desaturase
     HCH_01597
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FA_hydroxylase
Motif
Other DBs
NCBI-ProteinID: ABC28454
UniProt: Q2SLM0
Position
complement(1610738..1611868)
Genome map
AA seq 376 aa AA seqDB search
MKLINDYLSRHGHAPFKFGQGRISGYISATLGILSFLAILCFHFPEYLTTQELRQVYTEQ
FARTLLLVALCASFILGLLSFLLNQQKRLSMTGVLFSTAAVVAGGADIQLNSIGETPYSL
GLDWFILALFFSALVFIPMERAFAQKLETHTLRPEWRTDLAYFFMSHMLVQFILIFTTSS
STFLVGWVASDALRDAIQSMPVWAQFLLAVFMADFSQYWFHRLYHTVPFLWKFHAVHHSS
KHMDWLAGSRVHLVEILITRSVVMIPLFLLGFSAEALNAYVILVGVQAVLAHANLNFNFG
FLKYILVTPQYHHWHHADDPAYAYKNYAIHLPIIDMLFGTFKLPGKEWPKSYGLLNNKTV
PKGIIRQHMFPFGYDE
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgatcaacgattatctcagccgtcacggtcatgctcctttcaagttcggtcag
ggccgtatctccggatacatttccgccacacttggcattctcagtttccttgcaattttg
tgtttccatttccctgaatatctgaccacgcaggaattgcgtcaggtttacactgagcag
tttgctcgcactcttttgctggtagcgctttgcgcctcttttatacttggactgctcagc
ttcctgctgaaccaacaaaagcgcctcagcatgactggcgtgcttttttccactgcggcg
gtggtcgccggcggcgcggacattcagctcaacagcattggtgaaacaccctactcgctg
ggtctggactggttcattctggcgctgttcttctccgccctggtatttatccccatggag
cgcgcattcgcgcaaaaactggaaacacatacactgcgtcctgagtggcggaccgatctg
gcttacttttttatgagccacatgctggtgcagttcattctgattttcaccacttcatcc
tccacgttcctggttggctgggtagcctccgatgcgctgcgtgacgccattcaatccatg
ccagtctgggcgcaatttctgctggctgtatttatggctgatttctctcagtattggttc
caccgcctgtaccacactgtgccttttctgtggaagttccacgcagtacaccattccagc
aagcacatggattggttggccggctcccgcgtacacttggttgaaatactgatcactcgc
agcgtggtaatgattccactgttcctgctgggcttttccgccgaagcgttgaacgcctat
gttattttggtgggagtgcaagcggtgctggcgcacgctaacctgaatttcaacttcggc
ttcctgaaatacattttggtaacgccgcagtatcaccactggcaccacgcagacgatcct
gcatacgcctataagaactatgcgattcacttaccgattattgacatgctgttcggcacc
ttcaaactgccaggtaaagaatggccaaaaagctacggactactgaacaacaagaccgta
cctaaaggcatcattcgccagcatatgtttcctttcggatacgacgaataa

DBGET integrated database retrieval system