KEGG   Hahella chejuensis: HCH_01597Help
Entry
HCH_01597         CDS       T00307                                 

Definition
sterol desaturase (EC:1.14.21.6)
Orthology
K00227  
lathosterol oxidase [EC:1.14.21.6]
Organism
hch  Hahella chejuensis
Pathway
Steroid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hch00001]
 Metabolism
  Lipid metabolism
   00100 Steroid biosynthesis
    HCH_01597
Enzymes [BR:hch01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.21  With NADH or NADPH as one donor, and the other dehydrogenated
    1.14.21.6  lathosterol oxidase
     HCH_01597
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1610738..1611868)
Genome map
AA seq 376 aa AA seqDB search
MKLINDYLSRHGHAPFKFGQGRISGYISATLGILSFLAILCFHFPEYLTTQELRQVYTEQ
FARTLLLVALCASFILGLLSFLLNQQKRLSMTGVLFSTAAVVAGGADIQLNSIGETPYSL
GLDWFILALFFSALVFIPMERAFAQKLETHTLRPEWRTDLAYFFMSHMLVQFILIFTTSS
STFLVGWVASDALRDAIQSMPVWAQFLLAVFMADFSQYWFHRLYHTVPFLWKFHAVHHSS
KHMDWLAGSRVHLVEILITRSVVMIPLFLLGFSAEALNAYVILVGVQAVLAHANLNFNFG
FLKYILVTPQYHHWHHADDPAYAYKNYAIHLPIIDMLFGTFKLPGKEWPKSYGLLNNKTV
PKGIIRQHMFPFGYDE
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgatcaacgattatctcagccgtcacggtcatgctcctttcaagttcggtcag
ggccgtatctccggatacatttccgccacacttggcattctcagtttccttgcaattttg
tgtttccatttccctgaatatctgaccacgcaggaattgcgtcaggtttacactgagcag
tttgctcgcactcttttgctggtagcgctttgcgcctcttttatacttggactgctcagc
ttcctgctgaaccaacaaaagcgcctcagcatgactggcgtgcttttttccactgcggcg
gtggtcgccggcggcgcggacattcagctcaacagcattggtgaaacaccctactcgctg
ggtctggactggttcattctggcgctgttcttctccgccctggtatttatccccatggag
cgcgcattcgcgcaaaaactggaaacacatacactgcgtcctgagtggcggaccgatctg
gcttacttttttatgagccacatgctggtgcagttcattctgattttcaccacttcatcc
tccacgttcctggttggctgggtagcctccgatgcgctgcgtgacgccattcaatccatg
ccagtctgggcgcaatttctgctggctgtatttatggctgatttctctcagtattggttc
caccgcctgtaccacactgtgccttttctgtggaagttccacgcagtacaccattccagc
aagcacatggattggttggccggctcccgcgtacacttggttgaaatactgatcactcgc
agcgtggtaatgattccactgttcctgctgggcttttccgccgaagcgttgaacgcctat
gttattttggtgggagtgcaagcggtgctggcgcacgctaacctgaatttcaacttcggc
ttcctgaaatacattttggtaacgccgcagtatcaccactggcaccacgcagacgatcct
gcatacgcctataagaactatgcgattcacttaccgattattgacatgctgttcggcacc
ttcaaactgccaggtaaagaatggccaaaaagctacggactactgaacaacaagaccgta
cctaaaggcatcattcgccagcatatgtttcctttcggatacgacgaataa

DBGET integrated database retrieval system