KEGG   Hahella chejuensis: HCH_01642Help
Entry
HCH_01642         CDS       T00307                                 

Definition
choline dehydrogenase-like flavoprotein
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
hch  Hahella chejuensis
Brite
KEGG Orthology (KO) [BR:hch00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    HCH_01642
Enzymes [BR:hch01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     HCH_01642
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1650901..1656792)
Genome map
AA seq 1963 aa AA seqDB search
MHFHLSEPFETLIKDALPETRVHDTDVLIIGSGYGGSIAAMRLAGGKSSKSRASGASVTV
LERGKEYRPGDFPEALGDIPGHMQLLKSGSNRPIGYADALYDFRIGKEVDVLLGCGLGGG
SLINANVALEPDSETLAQAAWPREFREHPGLLRPHFQKVRHLLGVRNQDQTTRDRLRRLP
KFQALTRLARAIGAPVETAPLTVSLRPGANAVGVEQPGCNLCGNCVSGCNQGAKNTLAMN
VIPLAKARGARFYTGATVLTLEPIVPSADDNTTGSNRRRWRVRVRRTATEKNSLADEVFW
IEAATVILAAGALGSTEILLRSQESGRMRLSDRLGKRFSTNGDGFAMSYGQANPVMAIGR
SDDSLQAGEEPRVGPTITAVSRPMARHPNTGAEVRLTLEDGAAPYGVARLFGEIATTGAQ
LNRLTDMTLPAWFLNAGQNGVFKDPLAHHSDAMAHSQILLIMGDDGAIGGLSLRASDNPA
QQADTDYSRIRVEWPKAAENACLTAADALLRSQDRKEGFDGGQYLPNPLWKTLPDDASTV
MSGQLPGGRVITVHPLGGCAMGDGPDTGVVNHYGQVFKADNRAHGVDAPALHEGLYVLDG
SILPAALGVNPFLTISALSLRAAEAIQKQHDWLAPTQERVDPELAQALSPMRQPAATTTA
RPSPTVTLSISEQMFGRLQAQEVHTDLPDWIESWIRQWAEALPSSSQPASGAAARLTGDQ
GLIFKVETQIDDLHDWLQKPGKELKATAKLYLNPLSAEQTAKMHTYGLPPELLQDAIPIA
VGEGVVRLLHCDEPGPLATAWRGAQALNAYRTRRQSLSGFALRQLKQRLSRWDSDASQKQ
SAPGLAKQIKHFWTVAKHHAQYRRMSYNFQFTPNTKGSHAPLFENIPGAMIHLRGEKLLA
WKNSAPRLWRALTNLPIELSHERHGDAASGSLYVDMEYMSERGLAQVVKSPNLPESAMAA
AGLGMLFLRCLLQTQFWDFGSPHYPDKPIASNPHPRALRVAGNRVISPQRTELSVPLNDT
SSEQIGIVLTRYPQTNAQRPGQPLLLIHGLAQGSLIYCSEAIPENMAVYLWRAGFDVWVL
DYRLSNALPAPVPMQGWSIEEIARYDIPAAVRHIHRVNPGKINLFAHCVGATAAAMGILK
GWLDDPADPYIGRVAFNAIHPWIIPSPVNRSRAKLGSFLRDSVNDAQLNPIPQPNPSAFD
SMFDRLAFSFARLGELQEAEEGRARNGGERHTHSDHAPDGGVEISQGICDKMSFLYGRMW
RHDQISPATHKAFQDMLGQAPGAVYRHLYYFAQQQRVTSRDGENTFLTPSAVRKHWRYPT
LFLHGEQSKVFNPQSATRSAIRLSEMLKGCTPVPPVLLKRAPHYGHMDVILAQNAYKDVF
PSVRAFFSEDAECLRHSAGDRVEFHHQLFDSYRPSDDLHAANANLFSAGPIIRGAWLDNT
GIGRPRIVLRLWAELSDLADLADAQATPTRRLALEGAELIQCQFCVANDPHHLLLDVAVK
VDPAQERDVRIRFSLTQRQFDPAAQQALSQTVHIPASTGWLQRLRELCLHRGVSPAMRFL
VGSCRYPGAVLERDLADRVFVGMGRQVRGDAQLPGADSVFFIGDQIYADATAEAFDNTAL
KERYITRYRDAFNSPNMRKLLQLAPVHFAVDDHEFSDDCSGRPPQLDAHLKERERFDFAL
RAARSFQCSGRQPDALWYPQGVSARREFDCPVFVMDARTERRLRSAGVAGAQAEMIDATQ
FAALSNWLSEAQRLTPERPKFIFSGSVIAPVEKRLTQHPDLWRNNDSWCGYPHTLAAVMR
LIYERQIANVIFVGGDQHLCALARMTLANPADQAVSNRKPVTLWQIVSSGLYAPLPFANA
SPRDFEWEKPTVIPMHGSQLQLQAEARLLRADKSQFVRVDAIPAGESWTLEVRVCDPEGL
VAPVAQPMTLKDGELADDDRTWRIRLTANVEAEPGKPVRPEPA
NT seq 5892 nt NT seq  +upstreamnt  +downstreamnt
atgcactttcatctttccgaaccgtttgaaactttaattaaagatgcgctccccgaaacg
cgggtccacgacaccgacgtattgattatcggctccggctatggcggctccatcgccgcc
atgcgactggcgggcggcaagtcctccaaatccagggccagcggcgcgtcagtgacggtg
ttggaacgaggcaaagaataccgccctggcgatttcccggaagcgctgggcgatattccc
ggccacatgcaattactgaaatccggctccaaccgccctattggctacgccgacgcgctc
tatgattttcgcattggtaaagaagtggatgttttgttgggctgcgggcttggcggcgga
tcgttgattaacgccaatgtggccctggagccggattcagaaaccttggcccaggccgcc
tggcctcgtgagtttcgggagcatccaggactgctgcgaccgcattttcagaaagtgcgt
cacttgttgggagtccgcaatcaggatcaaaccacccgcgacaggctacgccgtctcccc
aagtttcaggcgctgaccaggctcgccagggcgattggcgcgccagtggaaacagcgcca
ttgactgtcagcttacgccctggcgctaacgccgtcggcgttgagcagccgggctgcaac
ctctgcggcaactgcgtttccggatgcaatcagggcgcgaagaatacgctggccatgaac
gtcattccactggcgaaagcccgcggcgccagattttataccggcgccacggttctcaca
ctggagcccatcgttccgtcagcagacgacaatacgaccgggtcgaacaggcggcgttgg
cgggttcgggtgcgacgcaccgccacggaaaagaacagtctggccgacgaggtattctgg
attgaagccgccaccgtcatcctggcggcgggcgccctgggcagcacggaaattctgttg
cggtctcaggagtccggccgcatgcggctttccgacagactgggcaaacgcttctccacc
aacggcgacggcttcgccatgagttatggacaggcgaacccggtcatggcgataggcagg
tctgacgactctttgcaagccggcgaggagcccagggttggccccaccatcaccgccgta
tcccgccctatggcgcgccatcccaacaccggcgccgaagtgcgcctgaccctggaggat
ggcgccgcgccctatggcgtggcgcgccttttcggcgaaatcgccacgaccggcgcccaa
ctgaaccgtctcaccgacatgaccttgcccgcctggtttctcaatgcaggccaaaacggc
gtgttcaaagaccctctggctcatcacagcgacgccatggcgcattcgcaaatccttctg
attatgggggacgacggcgccatcggcggactttctctgcgcgccagcgataaccccgcc
cagcaggctgacacggactattcccgcatccgcgtcgaatggcccaaagcggcggagaac
gcctgtctgaccgctgctgacgcgttgttgcgcagccaggacagaaaggaaggcttcgac
ggcggccaatacctccccaaccctctttggaaaacgctgccggacgacgcctctaccgtc
atgagcggccaacttcccggcggccgcgtcatcaccgtacacccgctgggcggctgcgcc
atgggcgatggtcccgacactggcgtcgtcaaccattacggtcaggtcttcaaggctgac
aaccgcgcccatggcgttgacgcgcccgctttgcatgaagggttatatgtgctggatggc
tccatcctgccggccgccctgggcgtcaatccattcctgaccatatccgcgctgtccctt
cgggccgcggaggcgattcagaaacaacatgactggcttgcgccgacgcaggagcgggtc
gatcctgagctggcgcaagccttatcgccaatgcgacagccagcggcgaccactacggcc
agacccagcccgacggtgacgctaagcatcagtgaacagatgttcggccgtttgcaggcg
caggaagtccacactgatctgcctgactggatagaaagctggatcaggcagtgggccgag
gcgcttccctcttcatcccagcccgccagtggcgccgctgcgcgcctcaccggcgatcag
ggactgattttcaaggtggaaacgcagatagatgatctgcatgactggttgcagaaacca
ggaaaggagctgaaagcgacggcgaaactgtacctgaatccgctcagcgcggagcaaacc
gccaaaatgcacacttacggcctgcctccggaactgttgcaagacgccattcccatcgcc
gtcggcgaaggcgtagtgcgtctgctgcactgcgatgagcccggtccgctggccaccgcc
tggcgcggcgctcaggcgctcaacgcttaccgcacccgacgtcaatccctgtccggtttc
gccttgcgtcagctcaaacagcgactcagtcgctgggattcagacgcctcgcaaaaacaa
tctgcgccagggctggccaagcaaatcaagcacttctggactgtcgccaagcatcatgcg
caataccgccgcatgagttacaacttccagttcacacccaacaccaagggctcgcacgcc
cctcttttcgaaaacattcccggggcaatgattcatctgcgtggagaaaagctgctggcc
tggaagaacagcgctcccagactctggcgcgccttgaccaatcttcccatcgagctgtcc
cacgaacgccatggcgacgccgcgtcgggctctctgtacgtggacatggagtacatgtcg
gaaagggggctggctcaggtggtcaaatctcccaatctgccggagtccgccatggcggcg
gcggggttgggcatgctgtttctacgctgcttgctgcaaacccagttctgggatttcggc
tcgcctcactatcccgacaagcccatcgcctccaatccgcatcccagagcgttgcgcgtc
gcgggaaaccgggtaatcagcccgcagcggaccgagctcagcgttcccttgaatgatacg
tcctcggagcagatcggtattgttttgacccgctatccgcaaaccaacgcgcagcggccg
ggtcagcctttgctgcttattcatggactcgcccagggcagccttatttattgctccgaa
gccatccccgagaacatggcggtctatctgtggcgcgccggctttgatgtgtgggtgctg
gattatcggctcagcaacgccctgcccgccccggttcccatgcagggctggagcattgaa
gagatcgcccgttacgacatacccgccgcggtgcgccatattcaccgggtcaacccaggc
aagatcaacctgttcgcccattgcgtcggcgccaccgccgccgcaatgggcattctcaaa
ggctggctggacgatcccgccgatccctatattggccgggtggccttcaacgccatccac
ccctggatcatcccttccccggtcaaccgcagccgcgcaaagctgggcagcttcctgcgc
gattccgtcaatgacgctcaactcaaccctatacctcagcctaaccccagcgccttcgat
tccatgttcgatcgtctggctttctctttcgcgcgcctgggcgagctgcaggaggcggaa
gaaggtagagcgcgcaacggcggcgagcggcatacgcacagcgaccatgcgcccgatggc
ggtgtggaaatctcccaaggcatctgcgacaaaatgagttttctgtacggccgcatgtgg
cggcacgaccagatttcccccgccacccacaaagcctttcaggacatgctgggacaagct
ccaggcgccgtctatcggcacctgtattacttcgcccagcaacaacgggtcacttcccgg
gacggcgaaaatacgtttctcaccccctctgcagtgcgcaaacactggcgttatcccacc
ctgttcctccatggcgagcaaagcaaggtattcaatccgcaatccgccacccgttccgcc
atccgcctcagtgaaatgctgaaaggttgtacgcccgtcccgccagtactgctcaaacgg
gcgccacattacggtcatatggacgtcattctggcgcaaaacgcttacaaggacgttttt
cccagtgtgcgcgcctttttcagcgaagatgcggaatgtctgcgccactccgccggcgac
cgcgtcgagtttcaccaccagttatttgacagctatcgtccatcagacgatctccatgcc
gcgaacgccaatctgttcagcgctggcccaattatccgcggggcctggctggacaacaca
ggcataggtcgcccccgcattgtgctgcgactatgggcggagctctctgatctggcggac
ctggcggacgcgcaggccacgcccacccgacgtctggcgttggaaggcgcagagttgatt
cagtgtcagttctgcgtcgccaatgatcctcatcatttattgctggacgtggcggtgaaa
gttgatccggcgcaggaacgggatgtgcgcatccgcttcagtctgacccagcgtcagttt
gatcctgcggcgcagcaggcgctgtcgcaaacagtgcatatccccgcctccacgggttgg
ctgcaacgcctgcgcgagctttgcctgcatcgcggcgtcagcccagccatgcgttttctg
gtgggatcatgccgttatccaggcgccgtgctggaacgcgatctcgctgatcgcgtcttc
gtcggtatgggacgtcaggtcaggggcgacgcccaattgcctggcgcggattcggttttc
ttcatcggggaccagatatacgcggacgccaccgccgaggcgtttgacaacacagctttg
aaagaacgctacatcactcgctaccgggatgcgttcaactcacccaacatgcgaaagctg
ctgcaactggcgcccgttcacttcgccgtggatgaccatgagttcagcgacgactgctcg
ggacgtccgccgcaattggacgctcatctgaaagaacgcgaacgtttcgatttcgcactc
cgcgccgcccgcagttttcaatgcagcggacgccagccggacgcgctctggtatccccag
ggcgttagcgcaaggcgggagttcgactgtccggtcttcgtcatggacgcccgcaccgaa
cgccggctgcgcagcgccggcgtcgccggggcccaagcggaaatgatcgacgcaacgcaa
ttcgccgccttatccaactggttatcagaagcacaacgactgaccccggagcggcccaaa
tttatcttctccggcagcgttatagcgccagtggaaaaacgcctcacgcagcacccggac
ttgtggcgcaataacgacagctggtgcggctatcctcacactctggcggcggtgatgagg
ctgatctatgagcggcagatcgctaacgtaatctttgtcggcggcgatcagcatctctgc
gccctggcgcgcatgaccctggccaatcctgcggatcaggcggtatcgaaccgcaaaccc
gttacgttgtggcagatcgtgtcgtccggcttgtacgcgccgctgcccttcgccaacgcc
agtccccgggattttgagtgggaaaaacccaccgtcattcccatgcacggctcacaatta
caactgcaggcggaggcgcgtttgttgcgggcggacaaatcccagttcgtgcgcgtggac
gctatccctgccggagagtcctggacgcttgaagtccgcgtatgcgatccagaaggtctt
gtggcgccagtggcgcaaccgatgacgctgaaagatggcgagctggcggacgacgacaga
acctggcgcatccggctgacggctaatgtggaggcggagccaggcaaacctgtgcgtcca
gaacccgcgtaa

DBGET integrated database retrieval system