KEGG   Hahella chejuensis: HCH_01653Help
Entry
HCH_01653         CDS       T00307                                 

Gene name
glcB
Definition
(GenBank) malate synthase G
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
hch  Hahella chejuensis
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:hch00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HCH_01653 (glcB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    HCH_01653 (glcB)
   00630 Glyoxylate and dicarboxylate metabolism
    HCH_01653 (glcB)
Enzymes [BR:hch01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     HCH_01653 (glcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1668801..1671074
Genome map
AA seq 757 aa AA seqDB search
MKRLRRSLRHHVAQVCRCAKGFRKPQESVLRLTMTDRVQVGGLQVAKVLYDFVNEKAIPG
TGVSADKFWSELEAVVNEMAPRNKALLKKRDELQAQIDAWHRENPGKVDLSAYKTFLQDI
GYLAPEADDFQIATANVDPEIATMAGPQLVVPVMNARFALNAANARWGSLYDALYGTDVI
SEENGAEKGKGYNPVRGAMVIEFARKFLDEAAPLASGSHKDSIGYSIESGRLAVKLQSGA
SIGLLDESKLAGYVGEPSAPEGILLQNNGLRFEVQIDADSPIGKTDPAGVKDVLMEAALT
TIQDCEDSVAAVDAEDKVVVYGNWLGLMKGDLAETFNKGGKSVTRTLHADREYIAPNGER
FSLPGRSLLFVRNVGHLMTIDAVLDSNGEEIPEGILDGMMTSLIAMHDLKGAGPLRNSKT
GSVYIVKPKMHGPEEVTFTNDLFARIEDALELPRFTLKVGIMDEERRTTINLKACIKAAA
DRVVFINTGFLDRTGDEIHTSMEAGPVVRKAAMKQQPWINAYEDWNVDTGLAAGLKGKAQ
IGKGMWPIPDEMAQMLQAKIGHPQAGANCAWVPSPTAATLHALHYHKVSVAARQEELASR
KRASLDDILTIPLLGDQALSAQDIQQELDNNAQGILGYVVRWVDQGVGCSKVPDINDVGL
MEDRATLRISSQHIANWLRHGVCSKEQVLETMQRMAAIVDRQNAGDPSYRNMAPNFDDSV
AFQAACDLVLKGCEQPNGYTEPLLHAYRRKAKAKFGG
NT seq 2274 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgtctgcggcgatctttgcggcatcatgtcgcacaggtctgtcgatgcgcgaag
ggattcaggaaaccacaagagagtgtgttgaggcttactatgacagatagagtacaagta
ggcggcttacaggtcgccaaggttctgtacgactttgtaaatgaaaaagcgatccccgga
actggcgtttctgcggataagttctggtccgagctggaagccgtcgttaacgaaatggct
cccagaaacaaggcgttactgaaaaaacgcgatgaactgcaggcgcagatcgacgcctgg
caccgcgagaacccaggtaaggtcgatctgtcggcctataaaacatttctacaagacatc
ggttatttggcgccggaagcggacgacttccagatcgccaccgccaatgtggacccggaa
atcgccactatggccggtccgcagctggttgtgccggtgatgaacgcccgtttcgccctt
aatgccgccaatgcgcgctggggcagtctgtacgacgcgctgtacggcactgacgttatc
tccgaagaaaacggcgcggaaaagggtaaaggctataatccggtgcgcggcgccatggtc
atcgagttcgcccgtaagtttctggacgaagccgctcctctggcctccggcagccataag
gactccatcggctatagcatagaaagcggacgtctggcggtgaaactgcagtccggcgcc
agcatcggtctgttggatgaaagcaaactggccggctacgtcggcgaaccctccgcgcct
gaaggcattctgctgcaaaacaatggattgcgtttcgaggttcagatcgacgctgacagc
cctatcggtaaaaccgatcccgccggcgttaaagacgttctgatggaagcggccctgacc
actattcaggactgtgaagactccgtcgctgcggtggacgcggaagacaaagtggtggtt
tacggcaactggctgggtctgatgaaaggcgatctggcggaaaccttcaacaagggaggc
aaatccgttacccgtacgttgcacgcagaccgtgagtatatcgccccgaatggcgagcgt
ttcagtttgccgggacgcagcctgttgttcgtgcgcaacgtcggtcatttgatgacgatc
gacgccgtgctcgacagcaacggtgaagaaattccggaaggcatactggacggcatgatg
acgtcgctgatcgccatgcatgatctgaaaggcgcaggccctctgcgcaacagcaagacc
ggcagcgtttatattgttaagcccaagatgcatggcccggaagaggtgacgttcaccaac
gacctgttcgcccgtatcgaagatgcgctggaattgccgcgcttcactctgaaagtcggc
atcatggacgaagagcgtcgcactaccatcaatttgaaggcgtgtatcaaggcggcggcg
gatcgggtggtgttcatcaataccggattcctggaccgcacgggcgatgaaatccacacc
agtatggaagcgggcccggtggtgcgtaaggcggcgatgaagcaacagccctggatcaac
gcttatgaagactggaacgtggataccggtctggcggcaggtctgaaaggcaaagcgcaa
atcggcaaaggcatgtggccgattcccgatgaaatggcgcagatgcttcaggccaaaatt
ggccacccgcaagcgggcgccaactgcgcctgggtgccgtctcccactgctgcgaccttg
cacgccttgcattatcacaaggtaagcgtggcggcgcgtcaggaggagctcgcctcccgt
aagcgggcgtctctggatgatatcctgactattccattgctgggcgaccaggctttgtcc
gcacaggatatccagcaggagctggataataacgcgcagggcatcctggggtatgttgta
cgctgggtcgatcagggcgtgggttgttccaaagtgcctgatattaacgacgtgggcctg
atggaagaccgcgccacgttgcggatttccagccagcatatcgccaactggctgcgccat
ggcgtttgctcgaaggagcaggtgctggaaaccatgcagcgtatggcggcgatcgtggat
cgtcagaacgctggcgaccccagctatcgcaacatggctccgaattttgacgatagcgtg
gcgtttcaagccgcctgcgacttggtgctgaaaggttgcgaacagcctaacggttacacc
gagccgttgctgcatgcatatcgtcgcaaggcgaaggcaaaattcggcggttga

DBGET integrated database retrieval system