KEGG   Hahella chejuensis: HCH_01727Help
Entry
HCH_01727         CDS       T00307                                 

Gene name
ispE
Definition
(GenBank) 4-diphosphocytidyl-2C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
hch  Hahella chejuensis
Pathway
hch00900  Terpenoid backbone biosynthesis
hch01100  Metabolic pathways
hch01110  Biosynthesis of secondary metabolites
hch01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:hch00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    HCH_01727 (ispE)
Enzymes [BR:hch01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     HCH_01727 (ispE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: ABC28574
UniProt: Q2SLA0
Position
complement(1752160..1753050)
Genome map
AA seq 296 aa AA seqDB search
MRNETLTLSSPAKLNLFLHITGRRPDGYHELQTLFQLLDYGDSLSFTPRDDQRITLEPSL
PGVPEADNLIIKAARLLKEHITATSPDKAGQISGVSIYINKKLPMGGGIGGGSSNAATTL
LALNRLWNADINTETLAALGLKLGADVPVFVRGATAFAEGVGDILHPVDTQEKWYLVVHP
NLHISTAKIFSDKWLTRDTPKSTIAPALEGDLENLRNDCETVVCRMYPEIREAINWLDQF
SPARLTGTGACIFASFSDKKRAEYVLSQMPTKYQGFVAKSINESPVLNELKQWRNH
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaacgaaaccctgaccctaagctctcccgccaagcttaatctttttctacacatc
accggcagacgccccgatggctaccatgaattacagacgttgtttcaattgttggattac
ggcgacagcctgagcttcactcccagggatgatcaacgtataacgctggagccaagcctc
cctggcgtgccagaagccgacaacctcatcatcaaagccgcccgcttattgaaagaacat
attacggcgacaagcccagacaaggccgggcaaatcagcggagtatccatctatataaat
aagaagctgccaatgggcggcggcataggcggcggcagttcaaacgcagcaacgacattg
ttggcgctaaataggttgtggaatgccgatatcaataccgagactttagctgcgcttggg
ttaaaactgggcgccgacgtacccgtattcgtccgcggcgcgacggctttcgctgaaggc
gtgggagacatactccatcccgttgacactcaggaaaaatggtatttagtcgtccaccca
aatcttcatatatctaccgcgaaaattttttcagataagtggttgacaagagacacacca
aaaagcacaatagcgcccgctcttgagggagatctcgaaaacctccgaaacgactgtgaa
acagtggtttgcaggatgtacccagagattcgcgaggcgataaattggctagatcagttt
tcgccagctagattaaccggaacaggggcctgcatttttgcaagcttctccgacaaaaag
cgagcggaatatgttctctcccaaatgccgacaaaatatcaaggctttgtcgccaagagc
attaatgaatcgccagttcttaacgaactcaaacaatggcgaaatcattaa

DBGET integrated database retrieval system