KEGG   Hahella chejuensis: HCH_01780Help
Entry
HCH_01780         CDS       T00307                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
hch  Hahella chejuensis
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:hch00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HCH_01780 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HCH_01780 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    HCH_01780 (thrC)
Enzymes [BR:hch01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     HCH_01780 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1804083..1805477
Genome map
AA seq 464 aa AA seqDB search
MKYVSTRGKAPALNFEEVLLTGLASDGGLYVPEFLPHFTPEEIASWAGLSYPELAVKVMY
PFVEDSLSIEEFSAIVNDAYSEFAHSAVAPLKQISANEWVMELFHGPTLAFKDYALQLLG
RLVDHFLEKRGQKVAILGATSGDTGSAAIEGCRHSKHVDIFILHPHGRVSEVQRRQMTTI
TGDNVHNLAVEGNFDDCQRMVKASFGDQAFLDGRPLVAVNSINWARIMAQIVYYFHAGLS
VGAPHRSVAFSVPTGNFGDIFAGYLARNMGLPVSQLVIATNRNDVLHRFMSNNQYNLQPL
QHTLSPSMDIVVSSNFERLLFDLHGRNGSLLAELMEKMNKEDVAIEEYRWRHARELFDSY
AVDDESTLASIDQIYAETEEIVDPHTAIGVKAARACRRDKKAPMVILATAHAAKFPEAVA
KAGVEEEPKLPAHMADLFEREERFTVLPNDLQAIQRFVQDQLKK
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
gtgaagtatgtaagcaccagaggcaaagcgcctgcgcttaactttgaagaagttctgttg
accgggttggcctcggatggcggcctgtacgtacctgagtttttacctcacttcacccct
gaggagattgcctcttgggctgggctgagttacccggagctggcggtcaaggtcatgtat
ccattcgtggaagactctctgtctatcgaagagttctccgctatcgttaatgatgcatat
tcagagttcgctcactccgctgtggcgccgctgaagcagatttcggcgaatgagtgggtg
atggagctttttcatggtcccactctggcgttcaaagattacgcgttgcaactgctggga
cgtctggttgaccattttcttgaaaagcgtggccagaaagtggcgattttgggagcgact
tctggtgatactgggtctgcggcgattgaaggatgccgtcattccaaacacgtcgatatt
ttcattctgcatccgcatggccgtgtctctgaagttcagcgtaggcagatgacgacgatt
acaggcgataatgtccataatctggcggtcgaaggcaactttgatgactgtcagcggatg
gtgaaggcgagctttggcgatcaggcgtttctggatggtcgtcctctggtagcggtgaac
tcgatcaactgggcgcggatcatggcgcagatcgtgtactatttccatgccgggctgagt
gtcggagcgcctcatcgcagcgttgcattctctgtgcccacggggaattttggcgatatc
tttgcgggttatctggcgcgcaatatgggcttgccggtgagccagttggtgatcgcgacc
aatcgcaatgatgtgctgcatcgttttatgagcaataaccagtacaacctgcagccgctc
cagcatacgctatctccaagcatggatattgtcgtgtccagcaactttgaacgccttttg
tttgatctacatggtcgcaatggctctttgctggcggagcttatggagaagatgaacaaa
gaggacgttgcaatcgaggagtatcgctggcgtcatgccagagagttgttcgactcctac
gctgtggatgacgaatctactttggctagcatcgatcagatttatgccgaaacggaagag
attgtagacccgcatacagcgatcggcgtcaaagccgcgcgcgcctgtcgtcgagacaag
aaggcgccaatggtgattctggctaccgcgcacgctgcgaaattccccgaagccgtggct
aaagctggcgtagaggaagagccgaagctacctgctcatatggcggacctgtttgaaaga
gaggagcgctttactgtgttgccgaatgatttgcaggcgattcagcgctttgtgcaggat
cagcttaagaaataa

DBGET integrated database retrieval system