KEGG   Hahella chejuensis: HCH_01845Help
Entry
HCH_01845         CDS       T00307                                 

Definition
double-stranded beta-helix domain-containing protein
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
hch  Hahella chejuensis
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hch00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    HCH_01845
Enzymes [BR:hch01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     HCH_01845
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     HCH_01845
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1874521..1875078
Genome map
AA seq 185 aa AA seqDB search
MSSLRIYNDNDFSQPLVFTEDGAEISRQLNEAGIRFERWSTRELDEGATPDSILAAYQEE
VEKLKAENGFTTADVVSLTPAHPQKDEFRKKFLDEHRHSEDEVRFFVRGQGLFYLHLEDK
VYVVLCRKNDLISVPNGTKHWFDMGPEPEFTCVRLFTNPEGWVAQFTGDEIASKAPRFEQ
LIEEA
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgagtagcctgcgtatttacaacgataacgacttttcgcaacccctggtgtttactgaa
gatggcgcggaaatttcccgccagctgaacgaagcgggcatacgctttgagcgttggtcc
acccgtgagctggatgagggcgctacgccggattcaatcctggcggcttatcaggaggaa
gtggaaaaactgaaggcggaaaacggcttcaccacggcggatgtggtcagcctgacccct
gctcacccgcagaaagatgaattccgtaagaaattcctggatgaacatcgtcacagtgaa
gacgaagtgcgctttttcgtgcgcggccagggcctgttttatctgcacttggaagacaag
gtgtatgtcgtgttgtgccgtaaaaacgacctgatcagtgttcctaacggaactaagcat
tggtttgatatggggcctgagccggagtttacctgcgtgcgtttgttcactaatcctgaa
ggttgggtggcgcagtttacgggcgacgaaattgcatcgaaagcgcctcgttttgaacaa
ttgattgaggaggcgtaa

DBGET integrated database retrieval system