KEGG   Hahella chejuensis: HCH_02013Help
Entry
HCH_02013         CDS       T00307                                 

Gene name
mutM2
Definition
formamidopyrimidine-DNA glycosylase (EC:3.2.2.23)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
hch  Hahella chejuensis
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:hch03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2054444..2055352)
Genome map
AA seq 302 aa AA seqDB search
MPEYPDITVYIDALERRVLGRVLESVELHSYFLLRTAEPSLEAVVGAKVTQLRRIGKRIA
IGFDNDVWMVFHLMIAGRLHWRDAGKKTPGKNALISLQFPNGVLFLTEAGTKKRASLHLV
SGERGLAQINPGGLEILEADLPAFQQALTRNNHTLKRALTDPHIFSGVGNAYSDEILHAA
RLSPIAQTQKLNAEEIERLYQACRSCLTTWTQRLRDQYGDAFPEKVTAFREDMAVHGRYN
LPCPVCGGAVQRIRYATNETNYCPDCQTGGRLLADRALSRLLKKDWPRSVEELEKVRGKN
DH
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaatatcctgacattactgtgtatatcgatgcgttggagcggcgggttcttggc
cgggtgttggagtcggtggagttgcatagttattttctgttgcggacggcggagccgtct
ttggaggcggtggttggcgcgaaggtgacgcagttgcggcggattggtaagcgtatcgcc
attggttttgataatgacgtttggatggtgtttcacctgatgattgcggggcgtttgcat
tggcgcgacgcaggtaagaaaacgccggggaagaatgcgttgattagtttgcagttcccc
aatggcgttttgtttttgacggaagcgggaaccaagaagcgggcgtcgctgcatcttgtt
tcaggggaaagaggattggcgcagatcaatccgggcggtttggagattttggaagccgac
cttcctgcgtttcaacaggcattgacccgcaataaccacaccttaaaaagagcgctcacc
gatccgcatattttcagcggcgtcggcaacgcttattccgatgaaattctgcatgcggcc
cgactatcccctatcgcgcaaacacagaaattgaacgcagaagagattgagcgactgtat
caggcgtgtcggtcctgtttgacgacctggacacaacgcttgcgcgaccagtatggcgac
gcctttccagaaaaagtcaccgcctttcgcgaagatatggcggtgcatggtcgctacaac
cttccctgcccggtctgcggcggcgccgtacagcgcattcgctatgcgaccaatgagacc
aactattgccctgattgccagacgggagggcgtttgctggcggatcgggcgctatcgcgt
ttgttgaaaaaagactggccgagaagcgttgaggagctggagaaagttcgcggcaaaaac
gatcactga

DBGET integrated database retrieval system