KEGG   Hahella chejuensis: HCH_02185Help
Entry
HCH_02185         CDS       T00307                                 

Gene name
fadB
Definition
3-hydroxyacyl-CoA dehydrogenase (EC:1.1.1.157)
Orthology
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
hch  Hahella chejuensis
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:hch00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HCH_02185 (fadB)
   01212 Fatty acid metabolism
    HCH_02185 (fadB)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    HCH_02185 (fadB)
   00650 Butanoate metabolism
    HCH_02185 (fadB)
  Lipid metabolism
   00071 Fatty acid degradation
    HCH_02185 (fadB)
   01040 Biosynthesis of unsaturated fatty acids
    HCH_02185 (fadB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    HCH_02185 (fadB)
   00310 Lysine degradation
    HCH_02185 (fadB)
   00380 Tryptophan metabolism
    HCH_02185 (fadB)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    HCH_02185 (fadB)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    HCH_02185 (fadB)
   00281 Geraniol degradation
    HCH_02185 (fadB)
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    HCH_02185 (fadB)
Enzymes [BR:hch01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     HCH_02185 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     HCH_02185 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     HCH_02185 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2241587..2243740)
Genome map
AA seq 717 aa AA seqDB search
MTAIRYEKDQENIVLLTMDMPGQSANTMNAEFRKAFRDILQRLQQDKDHIAGVIITSAKK
TFFAGGDLRELIQVNKEHAQEFLDMLTTSITQPLRQLELLGRPVVAAINGTALGGGWELA
LACHARIALADERIELGLPEVTLGLLPGGGGVARLPRYLGLEKALPLLLEGKKLSPQKAL
SMGLLHELAENQEGLIHAARAWIKANPSPQQPWDTKGYKIPGGSPSSPKVAQMLAIAPAM
LKAKTKGCYPAPEAILSAAVEGAQVDFDTAQKIESRYFTYLTTSQVAKNMIGTFWFQLND
LKAGQSRPKDIPTHKMSKVGVLGAGMMGSGIAYACAQRGLQVVLKDVEQASAEKGKAYSD
KILGKKVSQGRMTESQKQDVLDRITPTANISLMEGCDLIIEAVFENSELKAKVTQESEPM
LRPEGVFASNTSTIPITQLAQASSDPAKFIGLHFFSPVDKMQLVEIIVGESTSQESLAKA
FDFVMQIGKVPIVVNDSRGFFTSRVFGTFVNEGVAMLAEGIHPAAIENAAQLAGMPVGPL
ALSDEVSLTLITHIRDQSRKDVEAGGGKWSPHPAEQVIDAMVSEFERKGKAAGAGFYEYP
PQGAKHLWPQLVEKYTDMTKTQNTDLQELKDRLLFIQSLETMRCLEENVLRSVKDANIGS
IFGLGFAPWTGGAIQYANQYGLRQFVERANYLRERHGERFTPPALLVSLAEKGAIFE
NT seq 2154 nt NT seq  +upstreamnt  +downstreamnt
atgactgccatacgctacgaaaaagaccaagaaaacatcgtccttctgaccatggacatg
cccggccaaagcgccaatacaatgaacgcggagttccgcaaagcttttcgcgacatcctg
caacgactgcaacaagacaaagaccacatagcaggcgtcattattacttccgccaagaag
accttcttcgccggcggcgacctgagagagctgatccaggtaaataaagaacatgcccag
gagtttctggacatgctgacaaccagcataacccaacctctacgccaactggaattgttg
gggcggccggtcgtcgcggccatcaatggaaccgctctgggcgggggctgggagctggcg
ctggcctgccatgcccgtatcgctctggcggacgaacgaattgaactgggtttgccagag
gtaacgctgggattattgcccggcggaggcggcgtcgcccgtctgcccagatatctgggg
ctggagaaagcgcttccccttctactggaaggaaagaagctgtccccacagaaagcttta
tcgatgggactgctgcatgaactagccgaaaaccaggaggggcttattcatgccgcaaga
gcttggataaaagccaacccgtctccccaacaaccctgggatacaaagggctataaaatt
cccggcggctcgcccagcagccccaaggtggcacagatgctggcgattgctcccgctatg
ctgaaagccaaaaccaaaggctgctaccccgctccggaggcaatcctgtccgccgccgta
gaaggcgcacaggtagacttcgacaccgctcaaaaaatagaatcccgctactttacttat
ctcaccaccagccaagtggcgaagaacatgattggaaccttctggttccaattaaatgat
ttaaaagcaggacaaagtcgtccgaaagacattccaacgcacaaaatgagcaaagtcggc
gtacttggcgcaggcatgatgggctcaggcatcgcctacgcctgtgcgcaaagaggactg
caagtcgtgcttaaagacgtcgagcaggcctccgcagaaaaaggcaaagcctactcagat
aaaattcttggcaaaaaggtcagtcagggacgtatgacagagtcccaaaagcaagacgtt
ctcgaccgcattacgcccacagcaaacatcagcttaatggaaggttgcgaccttattatt
gaagccgtatttgaaaatagcgaattaaaggccaaggtgacccaggaaagtgagccgatg
ttgcgtccagagggcgttttcgcctctaacacttccaccatccccatcacacaactcgct
caggcttccagtgacccggcgaagtttatcgggctgcacttcttttccccggtggacaag
atgcagttagtggaaatcattgttggagagtccacctcacaggagagcctggccaaggct
tttgattttgtcatgcaaatcggcaaggttcccatcgtcgtgaacgacagcaggggcttt
ttcacctcccgcgtctttggcacattcgtcaacgagggcgtggccatgctggcggaaggc
atccaccccgccgctatcgaaaacgccgcacagcttgcagggatgccggtcggaccgctt
gctctgtcagacgaagtcagcctgacgctgataactcatatcagagaccaatcccgcaag
gacgttgaagcgggtggagggaaatggtcgccccatcctgcggagcaagtgattgacgca
atggtgagcgagtttgagcgcaagggtaaagccgccggagcgggcttttatgagtacccc
ccacaaggcgccaaacacctttggccacagctggtggaaaagtacactgacatgacgaag
actcaaaatacggacctgcaagagcttaaggatcgcttgctgttcattcaatcgttggaa
accatgcgctgcctggaagaaaacgttttgcgttcggttaaggacgccaacattggcagt
atctttggcctgggcttcgcgccctggacaggaggcgcaattcagtacgccaatcaatat
ggcttgcgtcagttcgtcgagcgcgccaattatctgcgcgaacgtcatggcgaacgcttc
acacctccggccttactcgtatcgctggcggagaaaggcgctatttttgagtag

DBGET integrated database retrieval system