KEGG   Hahella chejuensis: HCH_02304Help
Entry
HCH_02304         CDS       T00307                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
hch  Hahella chejuensis
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:hch00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    HCH_02304
  Metabolism of other amino acids
   00480 Glutathione metabolism
    HCH_02304
Enzymes [BR:hch01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     HCH_02304
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2365615..2366094
Genome map
AA seq 159 aa AA seqDB search
MSVYDYQVEDIKGAKRDMSEFKGKVLLIVNTASKCGFTPQFSGLESLYEKYKEQGLEVLG
FPCNQFMQQDPGENAEIAEFCQLNYGVSFPMFAKIDVNGDSAHPLYKFLKSQSKGLLGTE
AIKWNFTKFLVDKNGKVLERFPPTATPEKLEKPIKELLA
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtttatgactatcaggtagaggacatcaagggcgcgaagcgggacatgtcggag
ttcaagggaaaagtgctgttgatcgtcaacaccgccagcaaatgcggctttacgccacag
ttttccggtctggagtccttgtatgagaaatacaaagagcaggggctggaagttttgggg
tttccctgcaaccaattcatgcagcaggaccccggagaaaacgctgagatcgcggaattc
tgccagcttaactatggcgtcagcttcccgatgttcgccaagatcgatgtcaacggcgat
agcgcgcatcccctttataagtttctgaagagccaatccaaagggctgctggggacggag
gcgatcaaatggaacttcaccaaattcctggtggataagaacggtaaagttctcgaacgc
tttccgcctaccgctacgccggagaagctggaaaagccgatcaaggaactgttggcgtga

DBGET integrated database retrieval system