KEGG   Hahella chejuensis: HCH_02313Help
Entry
HCH_02313         CDS       T00307                                 

Definition
ribokinase family sugar kinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
hch  Hahella chejuensis
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:hch00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    HCH_02313
Enzymes [BR:hch01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     HCH_02313
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2375550..2376422
Genome map
AA seq 290 aa AA seqDB search
MKVLNFGSINIDYVYRVPHFVRPGETLASDSLSTVLGGKGANQSIALARAGVKTAHLGRV
SAADAWAVDLMRESGVDVATVSQIAEPSGHAIIQVDDAGENAIVLFGGANRSFSQQEVVS
AVSALDAGDWLLMQNECNGVEWAIAAAAERKVKIAFNPAPMTKEVKKLPLEQVDLLILNA
MEACDLAETADADAAFQALASKYPNTTVVVTLGGEGALVMSGGETVTRPADKVTPVDTTG
AGDTFVGYFLASLISGYEYSTALARAVKAAGIAVTRPGASPSIPTAQEVD
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgaaagttctgaatttcggttctattaatattgattatgtctaccgggtgcctcacttt
gtgcgcccgggggaaacactggccagcgactcgctgtcgacagttttaggcggcaaaggc
gctaatcaatccatcgcattggcccgcgccggcgttaaaactgcgcatttgggacgggtg
tccgcggcggatgcctgggcggttgacctgatgcgcgagagcggcgtggacgtcgccacc
gtttctcaaattgctgagcctagcggtcacgccattatccaggtggatgacgcgggtgag
aacgccatcgtgttgtttggcggcgctaatcgcagtttttcccaacaggaagtggtctcc
gccgtatccgctctggacgcaggcgattggctgctgatgcaaaatgagtgtaatggcgtg
gagtgggcgatcgccgcagcggcggagcgtaaggtgaaaattgcgttcaatcctgcgccg
atgacgaaagaggtcaaaaaactgcctttggagcaggttgacctgttaattctcaacgct
atggaagcctgcgacctggcggaaactgcggatgcggacgccgcatttcaggccctggcg
agcaagtacccgaacaccactgttgtggtgacattaggcggcgaaggcgctttggtcatg
agcggcggagagacggttacgcgtcctgctgacaaagtgacgcctgtggacactaccggc
gccggcgacacctttgtcgggtatttcctggcctcgcttatttccggttatgaatattcc
accgctctggcgagagcggtcaaagcggccggcattgcggtgacccgccctggcgcttcc
cccagtattccaaccgcccaggaggtggattga

DBGET integrated database retrieval system