KEGG   Hahella chejuensis: HCH_02398Help
Entry
HCH_02398         CDS       T00307                                 

Gene name
asnB3
Definition
glutamine-hydrolyzing asparagine synthase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
hch  Hahella chejuensis
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:hch00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2450213..2452201
Genome map
AA seq 662 aa AA seqDB search
MWKLLFMCGIFGWIGARLNVQHANQMLDQLAHRGPDDRGEWFYPEHKAWLGHRRLSILDL
SRAGRQPMLSENGRWALTFNGEIYNFRQIRRQLLDIGCHFTGSSDTEVLLRSIEQYGVME
TLERLVGMFAFAAYDVSDRKLYLARDRMGVKPLYYTVNGEEIAFSSELGPLRRLPWFDAQ
LNSDAMHAYFRYLAVPAPVSIFKQILKLKPGVVIEWSQSLGVRERAYWSVTESVSKGLLS
RKEKDPLDISRAADEMESLLSEAVSLRMVSDVPLGVFLSGGVDSSLVAAMMRKLSDKDIS
SFSIGFEEQSHDESGYARDVARSLRLKHHEAVLTERDAIDLVPEIAGAQDEPFADNSVIP
TYLLSKFTREKVTVALSGDGGDELFAGYPRYFWGDRISSLRKILTPLGARAVSGLLKSAP
VSFWDGFIHRLTSGRYTGSEGLAYRVRRFADYLSIPESEAYRKIISVWDTPGILVGVREL
QDLGSCIDQYPDIPWSEQMMACDQEHYLPNDILMKVDWASMRCSLEAREPLLDHRLVEWS
WTLPFRLKKADGVDQGKRVMRELLYRYVPSHLIERPKKGFGLPMDRWLRGSLRDWAESLL
DRTAMERSCLINSDYVTNMWRRHIGGENFSSRLWTILVFRSWEERVLLSRRKEVVAPPVA
LV
NT seq 1989 nt NT seq  +upstreamnt  +downstreamnt
atgtggaagctcctgtttatgtgtggaatctttggttggattggcgctcggttaaatgtg
caacacgcgaatcaaatgctggaccagttggcgcatagagggccggatgatcgtggggaa
tggttttaccccgaacataaagcctggcttgggcatcgtcgtctctctattttagattta
agccgcgcaggcaggcagcccatgctgagtgaaaatgggcgttgggcgctgaccttcaat
ggagaaatatataatttcagacaaataaggcgtcagttgttggacattggttgtcatttt
acaggaagttcggacacggaagttttattaaggagtatcgagcaatatggcgtcatggag
actttagagcggctggtcggaatgtttgctttcgccgcctatgatgttagcgatagaaaa
ctttatttggcgcgcgaccgtatgggggtcaaaccgctgtattacactgtcaacggagag
gaaatcgccttctcctctgagctggggcctctaaggcgattgccttggtttgacgctcag
ttaaatagtgatgcgatgcatgcttactttcggtacttggctgtacccgctccggtttct
atttttaaacagatattaaaattaaagcctggtgttgtgatcgaatggtctcaatcgttg
ggagtgagagagcgcgcttactggtcagttactgaatctgtcagtaaagggctgctgagt
agaaaggaaaaagaccctctcgatatttcaagagctgcggacgaaatggagtcgcttctc
agtgaagcagtatccctaaggatggtttctgatgtgccgttaggagtttttttatctggt
ggagtggactcctcgcttgtcgctgcaatgatgcgcaaactgtcagataaggatatttcc
tccttttctatcggctttgaagagcagtcacacgacgagtcgggttatgcgagagacgtg
gcgcgcagtttgcggcttaaacatcacgaagccgtactaacggagcgtgatgcgatagat
ttagttcctgaaattgccggcgcacaagatgaaccatttgctgacaacagcgttattccc
acttatctattaagtaaattcacgcgtgaaaaagtcacggtagcgctttcaggcgatggg
ggggatgaactgttcgccggatatccccgttatttttggggcgatcgaataagttcgtta
agaaagatattgaccccgctgggggcgagggcggtaagcggattattgaaatctgcgcct
gtttctttttgggacggatttattcatcgcttgacgagtgggcggtataccggcagcgag
gggttggcctatagggttcgtcgattcgccgactatctttccattccagaaagtgaggcg
tatagaaagatcatatcagtttgggatacgcctggtatcttggttggcgtaagagagttg
caggatctggggtcttgcattgatcaatatcctgacatcccatggtctgaacagatgatg
gcttgtgatcaggagcattacttgcccaacgatattttgatgaaagtagattgggcgtct
atgcgatgctctctggaggcgagagaacctttgcttgatcatcgtctggtcgagtggtct
tggactttgccttttcgattaaaaaaagcagatggcgtggaccagggcaaacgggtgatg
agggagttgctgtatcggtatgtgccgtcgcacctgatagaacggccaaagaaagggttc
gggctacctatggatcggtggcttagagggtccctccgcgattgggcggagtctctcttg
gatagaacggcgatggagcgctcctgtctgataaattccgattatgtgacgaatatgtgg
agacgccatataggcggagaaaacttctcttcacgattatggacaatacttgtgtttaga
agttgggaagagagagttttgctgagccgtagaaaagaagtagttgctccaccggtggcg
ctcgtttga

DBGET integrated database retrieval system