KEGG   Hahella chejuensis: HCH_02437Help
Entry
HCH_02437         CDS       T00307                                 

Gene name
trpA1
Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
hch  Hahella chejuensis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hch00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HCH_02437 (trpA1)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HCH_02437 (trpA1)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HCH_02437 (trpA1)
Enzymes [BR:hch01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     HCH_02437 (trpA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2491644..2492447
Genome map
AA seq 267 aa AA seqDB search
MSRIKQCLETLKANNKTALIPYVTAGDPAPQHTVAIMHALVESGADIIELGVPFSDPMAD
GPVIQLACERALEHGTSLRMVLGMVEEFRKTNTETPVVLMGYLNPVEAMGVHPFTDAAKA
AGVDGVLLVDLPPEEADMAAPHLKRAGLDVIFLIAPTTTEDRIAAAAKFGSGYLYYVSLK
GVTGSNALDIDDVEKHVNAIKALTDMPVGVGFGIKDAATAKAVSAVSDGVIVGSALVNTI
ATNAENPEQMRAKVKELLSSMRAAMDE
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgagccgaattaagcaatgcctggagacattaaaggcgaacaacaaaaccgcgctgatt
ccctatgtgaccgcaggcgatcctgcgccgcagcatactgtcgctatcatgcacgccttg
gttgagtcgggcgctgacatcatcgaattaggcgtgccgttttccgaccccatggcggac
ggccccgtgattcagctggcctgtgagcgcgccctggagcacgggacctccctgagaatg
gtgttgggcatggtggaggagttccgcaagaccaacactgagacgcctgtcgtactgatg
ggttatttgaatccggtggaagccatgggcgtgcatccgtttaccgacgcagccaaggcg
gcgggcgtggatggcgtattgctcgtggacttgccgccggaagaagcggacatggcggcg
ccgcacctgaaaagggcggggttggatgttatctttctgatcgctccaaccactacagag
gaccgtatcgccgccgctgcgaaattcggcagcggatatttatattatgtgtcgttgaaa
ggagtgactggctctaatgctctggacattgacgatgtggagaagcatgtcaacgccatc
aaggctctgaccgacatgcctgtcggcgtgggcttcggcatcaaagacgcggccacggcg
aaagcagtgtcggcagtatccgatggtgtaattgtcggtagcgcacttgtgaatacaata
gcgactaatgctgaaaatcctgagcaaatgcgcgccaaggtaaaagagctgcttagctcc
atgcgcgccgctatggacgaataa

DBGET integrated database retrieval system