KEGG   Hahella chejuensis: HCH_02475Help
Entry
HCH_02475         CDS       T00307                                 

Definition
cytochrome c peroxidase (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
hch  Hahella chejuensis
Brite
Enzymes [BR:hch01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     HCH_02475
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2533274..2534605)
Genome map
AA seq 443 aa AA seqDB search
MLRIKHIAAGVLAALSSVALAASDVYQFTNADRDFIARFSLSALPELPAAPSNKYADNEE
AAELGRKLFFDRSLSGNGQISCAQCHNPQLYFTDGLPQSQAIGTTRRSAPSIPGAIYGPW
QFWDGRSDSLWAQALSPVEDQNEHGLDRTSAAKIMATEYREEYVKLFGDANDLDAVSGLT
LPASPKVAGVAEKNWSQLSAAQQEAVNRVFANMGKAIMAYERKLELPPARFDQFIALLDE
KAGEEKLKSVMNEDEIKGMRLFMGKANCASCHNGPLFTNFEFHNIGAPEPDVKMVDMGRY
QGVTELTQNEFTCLSPWSDAELEQCEEMAFLKKQGPELVGAFKTPSLRNIAATAPYMQAG
QFATLMDVAQHYNKPKPPYYDREQHPSRPHFDIIPLGLTEEELAQLVAFLGSLTSPLPKD
DKWWRDPHLEANGDANELASTNQ
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgttgaggatcaaacatatcgcagcaggcgtactggcggcgctatccagcgtcgcgttg
gccgcctcggacgtctaccagttcaccaatgcggaccgggatttcatcgccagattttcc
ctgtccgccctccccgaactacctgccgcgcccagcaataagtatgcggacaacgaagaa
gccgctgagctgggccgcaagcttttctttgatcgcagcctgagcggcaatggtcagata
tcctgtgcgcaatgccacaatccacagctttattttaccgatggcctgccgcagtctcag
gcgattggaacgacgcgccgcagcgcgccgtctattcctggcgccatttacggtccctgg
caattctgggacggtcgctccgacagcctgtgggcgcaggcgctgtcgcctgtggaagat
cagaacgaacacggtcttgaccgcaccagcgccgccaaaatcatggcgacggagtatcgc
gaggagtacgtcaaactgtttggcgacgccaacgatctggacgcagtttccggactcacg
ctacccgccagccctaaggtcgccggcgtagcggaaaagaactggtcgcaactcagcgcc
gcccagcaggaagcggtcaaccgcgtgttcgccaatatgggcaaggccatcatggcctat
gaacgcaagcttgaactgcctcccgcccgcttcgaccagttcattgcattgctggatgaa
aaagccggcgaagagaagctgaaatccgtcatgaacgaggatgaaatcaaaggcatgcgc
ctgtttatgggcaaggccaactgcgccagttgccataacggccctttgttcaccaacttc
gagttccacaatatcggcgcgcctgagcctgacgtgaaaatggtcgacatgggccgctat
cagggcgtcaccgagctcacccagaatgagttcacatgcctgtccccctggagcgatgcg
gaactggaacagtgtgaggaaatggcgtttctgaagaagcaagggcctgaactggtgggc
gcgttcaaaacacccagtttacgcaatatcgccgccacagccccctatatgcaggcggga
cagttcgccaccttgatggacgtggcgcaacactataacaaacccaaaccgccctactac
gaccgcgaacaacaccccagccgcccgcactttgacatcattccactgggattgacggaa
gaagaactggcgcaactggtggcgtttctgggatcgttgacgtcacccttgcccaaggac
gacaaatggtggcgggacccgcatctggaggcgaatggagacgccaacgaactggcctcc
accaatcaatag

DBGET integrated database retrieval system