KEGG   Hahella chejuensis: HCH_02615Help
Entry
HCH_02615         CDS       T00307                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
hch  Hahella chejuensis
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:hch00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    HCH_02615 (recR)
DNA repair and recombination proteins [BR:hch03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      HCH_02615 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2684559..2685164
Genome map
AA seq 201 aa AA seqDB search
MSSSLTPAIDQLVRCLRYLPGVGAKTATRMALNLLERDQGRAADLAIAISDALTRVKRCS
RCQNFCEAELCSICESPKRDDRVLCVVESPTDVLAIEQTSDYSGRYFVLMGHLSPIDGIG
PEDIGVDKLKQLLQESAVSELILATNPTVEGEATAHFIAHIAKDLNIPVSRIAHGIPLGG
ELGMIDSGTLSHALQGRKPFA
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgtcttccagtctgacgcccgccattgatcagttggtccgttgtctgcgatatcttccc
ggggtgggggcgaagaccgccactcgtatggcgcttaatctactggaaagagatcagggt
agagcggcggatttggccattgccatcagcgatgcgcttaccagagtgaaacgctgctcg
cgctgccagaatttttgcgaagcggaattgtgttcaatctgcgaaagtcctaagcgggat
gatcgcgtgctctgtgtagtggagtcgccgacagacgtgctggcgattgagcagacatcg
gactatagcggtcgttacttcgtgctgatggggcatttgtcgccgatagacggcattggc
cctgaagacattggcgtcgataagcttaagcagctattgcaggaaagcgccgtcagcgag
ctgatccttgccaccaaccccactgtggagggcgaagcgacagcgcattttatcgcccac
atcgccaaagacttgaacattcctgtgtcccgcatcgcccacggcatcccccttggagga
gagctgggcatgattgacagcggcacgttaagtcacgcactgcaaggtcgaaaacctttt
gcctaa

DBGET integrated database retrieval system