KEGG   Hahella chejuensis: HCH_02679Help
Entry
HCH_02679         CDS       T00307                                 

Definition
beta-glucosidase-like protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
hch  Hahella chejuensis
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Module
beta-Lactam resistance, AmpC system
Brite
KEGG Orthology (KO) [BR:hch00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    HCH_02679
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    HCH_02679
Enzymes [BR:hch01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     HCH_02679
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2747484..2748524
Genome map
AA seq 346 aa AA seqDB search
MSKTAKLGPLIIDLKGLDVSAEEKELLSRPIVGGVIFFARNYTDPQQLDALVRQIRAIRP
ELLLCVDQEGGRVQRFREGRTLLPAPGKLRASYQENPAAAKAMATELGWLTAVELRELDL
DFSFAPVLDVDYGKNKVIADRAFGDTPTMAAALAQAFWRGMGEAGCAGVGKHFPGHGFVT
EDTHIESARDPRAYEELLGADMRPFIEMIEAGIEAMMPAHVIYPACDPSPASQSSFWLTQ
VLRERLQYQGAIISDDMGMQGADLEAEEDESASVVRALRAGCDLLMACNNPERLLRVADQ
LESLPGELLFPEDSLRRRHSMRRRPQGAVDPARLAQARELAQSLRQ
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagacagcaaaactgggtcctttgattatcgatcttaaggggctggatgttagc
gcggaagaaaaggaactactgagccggcctatcgtgggcggcgtcatattcttcgcacgt
aattacactgatccgcaacagctggacgcactagtcagacaaatccgcgcaatacgaccg
gaactgcttctttgtgtggatcaggaagggggacgggtgcagcgcttccgggaagggcgg
actttattgccggccccaggaaaactgcgtgcaagctatcaagaaaatccagcagcggcc
aaagcaatggccacagagttgggatggctcaccgccgtagagctcagagagcttgatttg
gatttcagcttcgcgccggtgctggatgtggattacggcaaaaacaaagtgatcgccgac
cgcgctttcggcgatacgccgacgatggcggcggcgttggcgcaagctttctggcgcggg
atgggggaggccggttgcgcaggcgtaggcaagcacttcccgggacatggttttgtaacg
gaagacacgcatatagagagcgcccgcgacccacgtgcttatgaagaactgttgggcgcg
gatatgcggccttttatcgaaatgattgaagctggcatcgaggcgatgatgcccgctcac
gttatttaccctgcttgcgatccgtctcccgcaagccaatccagtttctggctcacccag
gttttgcgtgagcggctgcagtatcaaggcgccattatcagtgacgatatgggcatgcag
ggggcggatctggaggctgaggaagatgaaagcgccagcgttgtcagggcgttgcgggcg
ggctgtgacttgttgatggcgtgcaacaatcctgaacgtttactcagggtcgctgatcaa
ttggagtccctgcctggcgagctactgtttccagaggattctctgcgtcgtcgccacagt
atgcgacgacgtcctcagggggcggtggacccggcgaggctggcgcaggcccgtgagctg
gcgcaaagtctgcgccaataa

DBGET integrated database retrieval system