KEGG   Hahella chejuensis: HCH_03146Help
Entry
HCH_03146         CDS       T00307                                 

Definition
Fatty-acid desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
hch  Hahella chejuensis
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:hch00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    HCH_03146
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    HCH_03146
Enzymes [BR:hch01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     HCH_03146
Lipid biosynthesis proteins [BR:hch01004]
 Desaturase
  First
   HCH_03146
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3238827..3239801
Genome map
AA seq 324 aa AA seqDB search
MRTNQGVPRIQETANCCPDTGEVVWAPLKSFWYLGHLLIALIGGYLTFSLDALLVFVVFT
AATLCLGHSLGMHRRLIHGSYECPKWMEYFFVHLGVLVGMAGPLGMVYQHDLRDWAQRKA
KCHSYLRHGTRFLTDGWRQLNCDLRLEHPPEFCPESAIKDDPVYRFMERTWMWQQLPWAL
LLYWLGDIGWVVWGISARIAVSVTGHWLIGYFAHNSGERDWHVNGAAVQGHNVRFAGLLT
MGESWHNNHHAFPGSAMLGIYKGQSDPGWWVLNRLMNIGLVWNVRLPEHLPVRPELSPLT
PARAEKALLKTPSSCRLKPQWRSS
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgcgaacgaaccagggcgttcccagaattcaagaaacggctaattgttgcccggacacg
ggtgaggtggtgtgggcgcctttgaaatccttttggtatttggggcatttgttgattgcg
cttattggtgggtatttgacgttttcgctggatgcgttgttggtgtttgttgtgtttacc
gcggcgacgctttgtctgggacattccctggggatgcatcggcggttgattcatgggagt
tatgagtgtccgaagtggatggagtatttcttcgtgcatctcggggtgttggtggggatg
gcggggccgttgggaatggtgtatcagcatgatctgcgggactgggcgcagaggaaggcc
aagtgtcattcgtatcttcgccatggaacccgttttttgacggatgggtggcggcagctg
aattgtgatttgcgtctggagcatcctcccgagttttgtccagaaagcgccatcaaagat
gatcctgtctatcggtttatggaaagaacctggatgtggcaacaattaccctgggcgctc
ttgttgtattggctcggagacattggctgggtggtctgggggatctcggcgcgtattgcg
gtgtctgtgacggggcattggcttatcggatactttgcgcataacagcggcgagcgggac
tggcatgtcaatggcgcggcggttcagggacataacgttcgctttgcaggactgctgacc
atgggagagtcctggcataacaatcatcacgctttccctggctccgccatgctggggatt
tataaaggacagtctgatcccggttggtgggtgttaaaccggcttatgaatatcggactg
gtgtggaacgttaggttaccggagcatttgcccgtcagaccggagctaagcccattgacg
ccagcgagggcggagaaagcgttgctgaaaaccccttcgtcctgccggctcaagccgcag
tggcgctcatcgtaa

DBGET integrated database retrieval system