KEGG   Hahella chejuensis: HCH_03622Help
Entry
HCH_03622         CDS       T00307                                 

Definition
arginase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
hch  Hahella chejuensis
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:hch00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    HCH_03622
Enzymes [BR:hch01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     HCH_03622
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3761361..3762302
Genome map
AA seq 313 aa AA seqDB search
MYERVVNDQSLKWVSEAWVKDVEDAAGGVSGSDLITFMEIPFDFAVSHRPGTRFGPAAIL
EALNGFSLYCTDKRADLSSLRFRRGAPVPVSNDIHQTYSRIEEAVTSLPPSTMPIFLGGD
HSITDPIMRGLLKRSGGQRFGLIVFDAHFDSRPPVKGQEHSGHWMYTVQEVYSHANSVQL
GVNAPIYSREYMERAERAGVMVRTPYEIRRDGWLHTLEEAIAHASRNTDGVYVSVDIDCL
DRAFAQGTSVPNGCGLMAYEVADALYEIARKTKTIGLDIVEVSPPLDDASNTAEVAAHFV
MNYLAGLTERRRD
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgtatgagagagttgtgaacgaccaatcgttgaaatgggtatccgaagcctgggtcaag
gacgtggaggacgccgctggcggagtctccggttcggatttgatcacctttatggagata
cccttcgatttcgccgtaagccatcgccctggaacccggttcgggcccgccgccattctg
gaagcgctgaatggtttcagtctttattgcacggacaagcgcgcggatctctcctctctg
cgtttcaggcgtggcgcgccggtccccgtcagcaatgatattcatcagacttattcccgc
atcgaagaagccgtgacgtcgctgccgccctccacaatgccgatattcctgggcggcgat
cattccatcacggacccgattatgcggggacttcttaaacgctccggcggccagcgtttc
ggcttgatcgtgttcgacgcgcattttgattcacgtccgccggtcaaaggccaggaacat
tcagggcactggatgtatacggtgcaggaggtgtatagccacgccaacagcgtgcagctg
ggcgtgaacgcgccgatctattcacgggagtatatggagcgcgcggagcgggctggcgtc
atggtgcgcacgccctatgaaatccgccgcgacggctggctccacaccctggaggaagcc
atcgcccacgcctcccgcaataccgatggcgtatatgtgtccgttgacatcgactgtctc
gaccgcgccttcgcccaaggcaccagcgtccctaacggctgcggcctgatggcgtacgaa
gtcgccgacgccctctacgaaatcgcccgcaaaaccaaaaccatcggcctggatattgta
gaagtcagcccgcccctggacgacgcctccaacaccgcggaagtcgccgcccacttcgtc
atgaactacctcgccggcttgaccgaaagacgacgcgactaa

DBGET integrated database retrieval system