KEGG   Hahella chejuensis: HCH_03703Help
Entry
HCH_03703         CDS       T00307                                 

Definition
chemotaxis response regulator
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
hch  Hahella chejuensis
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:hch02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:hch02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3848963..3850069)
Genome map
AA seq 368 aa AA seqDB search
MNAKIKVLLVDDSAVVRQVLQQVLERDKNIEVIGAAADPIFAQLRMSKQWPDVIVLDVEM
PRMDGITFLKKLMAERPTPVVMCSTLTSKGAQTSMKALAAGAVAVVAKPAVGVKEYLESA
AGELIMEIKAAAKANMRNMPAATASAQSMALPAKFSADAVIPLRTGGVIAGANKIAALGT
STGGTQALEYVLTRLPRNCPGIVIVQHMPEKFTAAFAERLNSICELEILEAESGHQVAPG
RALIAPGGKHMLLRRSGAQYFVEIMSGPPVNRHRPSVDVLFRSVAQAAGRNALGVIMTGM
GDDGAKGLLEMRNAGALTIGQDERSCIVYGMPKEAAKIGAVTREISLERIPQCVLDMGAS
LTASAQRG
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgaacgctaagatcaaggtcttgctggtggacgactcggctgtggtcaggcaggtgctg
caacaagtgctggagcgggacaaaaatatcgaagtgatcggcgccgcggcggaccctatt
ttcgcgcaattgaggatgagcaagcagtggccggatgtgatcgtgctggatgtggagatg
ccgcgcatggacggcatcacctttttgaaaaaactgatggcggaacggcccacgccggtg
gtgatgtgctccaccctgaccagcaagggcgcgcagaccagcatgaaagcgctggccgcc
ggtgcggtggcggtggtggccaagcctgcggtaggggtgaaggaatatctggagagcgcc
gctggcgagctgatcatggaaatcaaggcggcggcgaaggccaacatgcgcaatatgccc
gccgcgacggcgtctgcccagtccatggcgctccccgccaaattctccgcggacgcagtg
attcccctgcgtacaggcggcgtcatcgccggcgccaataaaatcgctgcgttaggcact
tccaccggcggcactcaggcgttggagtacgttctgacccgtttaccccgtaattgccct
ggcatcgttatcgtgcagcatatgccggaaaagttcaccgcggctttcgctgagcgtctg
aacagcatctgcgagctggaaattctggaggcggaaagcggccatcaggtggcgccgggg
cgtgcgctgattgcgcccggcggcaagcatatgctgttgcggcgcagtggcgcgcagtat
tttgtggagatcatgtccgggccgccagtgaaccggcatcggccctccgtcgacgttctg
tttcgttccgtggcccaggcggcgggacgcaacgctttaggagtcatcatgaccggcatg
ggcgacgacggcgccaagggattgctggaaatgcgcaatgccggcgctttaaccattggt
caggatgagcgctcctgcattgtctacggcatgccgaaggaagcggccaagattggcgcg
gtgacccgggaaatctctctggagcgcataccgcagtgtgttctggatatgggagcgtct
ctcaccgccagcgcccagcggggatga

DBGET integrated database retrieval system