KEGG   Hahella chejuensis: HCH_03914Help
Entry
HCH_03914         CDS       T00307                                 

Definition
endoglucanase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
hch  Hahella chejuensis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hch00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    HCH_03914
Enzymes [BR:hch01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     HCH_03914
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4058090..4059949)
Genome map
AA seq 619 aa AA seqDB search
MSKRSERRLSRLLEGALKKRHGKNWRRYENVFIFGLLFGCATLAHAVPPLSVQGNKVVSG
GQQVSLGGNSLFWSNNGWGGERFYNSGAVGAIKNDWKSSIVRAAMGVDEGGGYLQDREGN
RNKVISVVDAAIANDMYVIIDWHSHHAHQYKNEAIEFFQDMARRYGDKNNVIYEVYNEPL
DVSWSGVIKPYAEAVIDAIRQVDPDNLIIVGTRQWSQEVEEASWDPIRKNNIAYTLHFYA
GTHKQWLRDKAQNAMNNGIALFVTEWGTVDASGDGAVNESETWAWVDFMRNHGISHANWA
LNDKAEGASTFWPGASGTGGWNDGNLTPSGKLVKSIIQSSDPIPGGDDPGPGPDCGSVSA
PGKVQAENYCEMEGVEKENTSDAGGGQNLGYIDSGDWMTYKINVPSNGVYTLSYRVASLN
GGGIIQAEKAGGSPVYGSVEIPSTGGWQNWKTISHDIQLSAGEQRIGLAAVSGGFNLNWF
DVTQKGGPAPNAITVQAEEYLVMSGVELENTSDAGGGKNVGYIDANDWMSYPEVDIPESG
VYTVEYRVASLYGGGVMQFEKAGGDIVYGSVDVPNTGGWQTWKTIKHQVTLEAGKQRFGI
YAPAGGWNLNWFKITKGQK
NT seq 1860 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagagatcagaaagaaggctttccagactattggagggcgcattgaaaaaacgt
catgggaaaaattggcgccgatatgaaaacgttttcatatttggtttattgtttggctgc
gcgaccttggcccacgctgtgccgccgttatcggtgcagggcaataaagtcgtcagtggc
ggtcagcaagtcagtctgggaggcaacagcctgttttggagcaacaacggctggggaggg
gagcgcttttataattccggcgcggtaggggccatcaaaaacgactggaagtccagcatt
gtgcgggccgccatgggggtggatgaaggcggcggatatttacaggaccgggaaggcaac
cgtaataaagtcatctccgtggtggacgccgccatcgccaatgatatgtacgtcatcatc
gactggcactcccaccatgctcatcagtacaagaacgaagccatcgagtttttccaggac
atggcgcgccgctacggcgataaaaacaatgttatttacgaagtctataacgagccgctg
gatgtgtcctggagcggcgttatcaagccctacgccgaggcggtgattgacgctatccgc
caagttgatccagataacctgatcattgtcgggactcgccaatggtcgcaggaagtggag
gaagcctcctgggaccctatccgcaagaacaatatcgcctatacgctgcatttttacgcc
ggcacgcataagcagtggctgcgcgacaaagcgcaaaacgccatgaacaacggcatcgca
cttttcgtgacggagtggggaaccgtagacgccagcggcgatggcgcggttaatgaaagt
gaaacctgggcctgggtcgacttcatgcgcaaccacggcatcagccacgccaactgggcg
ctgaatgataaagccgaaggcgcctcaacgttctggcctggggctagtggaaccggtggt
tggaatgatggaaacctgacgccttccggtaaactggtgaaatccattatccaaagctcc
gaccccattcctggcggcgatgaccccggtcctggtccggactgcggatcagtctccgcg
cccggcaaggtgcaggcggaaaactactgtgaaatggaaggcgtcgagaaagagaatacc
tctgacgccggcggcggtcagaatcttggctacatcgactccggtgactggatgacttat
aagattaacgtgcccagcaacggggtctacactctttcctatcgggtggcgagtctgaac
ggcggcggcataatacaggcagagaaagccggtggttcgcctgtgtatggttctgtagag
attccatccacgggcggctggcaaaactggaaaacgatttcacacgacattcagttgagc
gcaggagagcaacgcatcggcttggcggcagtgtcaggcggtttcaatctgaactggttt
gacgtcacccagaaaggcggaccggcgccgaacgccattaccgtgcaggcggaagagtac
ctggtgatgagcggcgtggagctggaaaacaccagtgacgcaggcggcggtaaaaacgtc
gggtacatcgacgccaatgactggatgtcctacccggaggtcgatattccggaaagcggc
gtttataccgtggagtatcgtgtggcgagcctgtatggcggcggcgtgatgcagtttgag
aaagcaggtggagatatcgtgtatggcagcgtggatgtgccgaacacaggcggctggcaa
acctggaaaaccatcaagcatcaggtcaccctcgaagccggtaagcagcgctttggcatt
tatgcgcccgctggcggctggaacctgaactggttcaagatcactaaaggacaaaaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system