KEGG   Hahella chejuensis: HCH_04744Help
Entry
HCH_04744         CDS       T00307                                 

Gene name
sucB2
Definition
dihydrolipoamide succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
hch  Hahella chejuensis
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:hch00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HCH_04744 (sucB2)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    HCH_04744 (sucB2)
  Amino acid metabolism
   00310 Lysine degradation
    HCH_04744 (sucB2)
Enzymes [BR:hch01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     HCH_04744 (sucB2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4878000..4879235)
Genome map
AA seq 411 aa AA seqDB search
MAIEIKAPTFPESVADGVVATWHKKPGESVARDELLVDIETDKVVLEVVAPAAGVIEKVL
KGEGDTVLSEEVIAVFKEGAAGTAAPAAAEEKPQAAPAATEAKSGQEAILSPSARKMAEE
NNLNPSDIQGTGKGGRVTKEDVINHLSSNTTSVTAEVKSSAQPAAAPTMPAIESPAGARP
EKRVPMTRLRASIARRLLEAQHNSAMLTTFNEVNMKPIMDLRKQYKDLFEKRHNGVKLGF
MSFFVKAACEALKRFPAVNASIDGNDIVYHGYQDVGVAVSTERGLVVPILRDADQMGLAD
IESTIGDFGKKARDGKLAIEDMTGGTFTISNGGVFGSLMSTPILNPPQTAIMGMHKIQER
PMAVNGQVVILPMMYLALSYDHRMIDGKEAVQFLVTIKDLLEDPARILLDI
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atggcgatcgaaattaaagctcctactttcccagagtccgtcgcggacggcgtagtggcg
acttggcataaaaaacctggggaatccgtggctagggacgagctactggtcgatatcgag
acggataaagtggtgttggaggttgtagcgcctgctgccggcgtcattgagaaagttctc
aaaggcgaaggcgatacggtgcttagcgaagaagttattgcggtatttaaagagggtgcg
gctggaacggcggcgcctgccgcagcggaagaaaagccacaggctgctcctgcggcgact
gaagctaagtctggtcaggaagcgattctgagtccatccgcgcgcaaaatggcggaagag
aacaacctgaatccttccgatattcagggcacaggtaaaggcggtagagtcaccaaggaa
gacgtgattaaccacctgtcttccaacactaccagcgttaccgctgaagtgaagtcctcc
gctcagcctgcagcggcgccgactatgcctgctatcgaatctccagcgggagcgcgtccc
gagaagcgcgtgccgatgactcgcctgcgcgccagcatcgcgcgtcgtctgctggaagct
cagcataactctgcaatgctgactaccttcaacgaagtcaacatgaagccgatcatggat
ctgcgtaagcaatacaaagatctgttcgagaagcgtcataatggcgtgaaactgggcttc
atgtccttcttcgttaaagcggcttgcgaagcgttgaagcgtttccccgctgtgaatgcg
tccattgatggcaacgatattgtttaccacggttatcaggatgtcggcgtagcggtatcc
actgagcgcggtctggttgttcctatcctgcgcgatgcggatcagatgggcctggcggat
attgaatccaccatcggcgacttcggtaagaaagcgcgcgacggcaagctggcgatcgaa
gacatgactggcggcacgttcaccatttccaatggcggcgtgttcggttcattgatgtcc
acgccgattctgaatcccccgcaaaccgccattatgggaatgcacaagatccaggaacgt
ccgatggcggtaaacggccaggtggtgattctgccgatgatgtacctggcgctgtcatac
gaccaccgcatgatcgacggtaaggaagcggtacagtttttggtgaccatcaaggatctg
ctggaagatcctgcgcggattctgctggatatctaa

DBGET integrated database retrieval system