KEGG   Hahella chejuensis: HCH_04748Help
Entry
HCH_04748         CDS       T00307                                 

Gene name
sdhD
Definition
(GenBank) Succinate dehydrogenase, hydrophobic anchor subunit
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
hch  Hahella chejuensis
Pathway
hch00020  Citrate cycle (TCA cycle)
hch00190  Oxidative phosphorylation
hch00650  Butanoate metabolism
hch01100  Metabolic pathways
hch01110  Biosynthesis of secondary metabolites
hch01120  Microbial metabolism in diverse environments
hch01130  Biosynthesis of antibiotics
hch01200  Carbon metabolism
Module
hch_M00009  Citrate cycle (TCA cycle, Krebs cycle)
hch_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
hch_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:hch00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    HCH_04748 (sdhD)
   00650 Butanoate metabolism
    HCH_04748 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    HCH_04748 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS
Motif
Other DBs
NCBI-ProteinID: ABC31445
UniProt: Q2SD29
Position
complement(4884902..4885249)
Genome map
AA seq 115 aa AA seqDB search
MVTSVTNLGRSGAYDWMVQRVSAVVLALYTAFMVGVLVFTPDLTYEVWSALFAKTWMRIF
SLAALVALGAHAWIGLWTITTDYMKNGVIRFVAQAACGTIMFVYFIWGVQILWGL
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggtaaccagcgtcaccaatttaggccgtagcggcgcatatgattggatggtgcagcgg
gtctccgctgtggtgttggctctttatactgcatttatggttggcgtcctggtgtttacg
ccggatctgacctatgaagtatggagcgcactgttcgccaagacttggatgagaattttc
tccctggctgcgctggtggcgcttggcgcccatgcgtggataggtttgtggacgattacc
actgactacatgaaaaacggcgtgatccgtttcgttgcgcaagcagcgtgcggaactatc
atgtttgtttacttcatctggggcgtgcaaattttgtgggggctgtaa

DBGET integrated database retrieval system