KEGG   Hahella chejuensis: HCH_04893Help
Entry
HCH_04893         CDS       T00307                                 

Definition
nucleoside-diphosphate-sugar epimerase
Orthology
K00091  
dihydroflavonol-4-reductase [EC:1.1.1.219]
Organism
hch  Hahella chejuensis
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5027680..5028720
Genome map
AA seq 346 aa AA seqDB search
MKVLVTGANGHIGSHVVRQLLDQNHEVRAFVRKSSDLRGLNGLKPEFAYGDVKDPAAMEA
AAEGCDAIIHMAAVYKTIAKSIEEIVEPALQGAENVFKAAHKHGIKRVVYTSSVASIGFS
YDPQALRSGEDWNDDAQNAYYVAKTRSERAAQKLAREYDIHLVVICPAIVLGPNDYRITP
SNQLVMDWLNGFGQTYPGGLNLVDVRDVAAAHVAALSKGENCKRYVVGGENIEVKEIGVA
LKRLTGVKPIHLPTGRGLTLTFARVVETLCKLLHIKPPFTYDLVYEVVGRYAYYDCSEAA
KDLGVEPRDAEETLKDCIAWLLSQNKLKPRVAAKVAPKIPTHPASA
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtattggtaaccggagcaaacggacatatcggctcccacgtggtacggcaacta
ctcgaccaaaaccatgaagtgcgcgcctttgtgcgcaaaagctcagacttgcgcgggctc
aacgggctcaagccggaattcgcttacggcgatgtcaaagaccctgccgccatggaagcc
gccgccgaaggttgcgacgccatcattcatatggctgcggtgtacaagaccatcgccaag
tccatcgaggaaatcgtcgagccggccttgcaaggcgcagaaaatgtattcaaggccgcc
cataaacacggtattaagcgtgtggtgtacaccagctctgtagcctccatcgggttttcc
tatgacccacaggcattgcgcagcggcgaggactggaatgacgacgcgcagaacgcctat
tacgtagccaagacccgcagtgagagagccgcgcagaaactggcccgcgaatacgacatt
cacctggtggtcatctgccccgctatcgtgttgggcccgaacgactatcgcatcactccc
tccaaccaattagtgatggattggttgaacggtttcgggcaaacctaccctggcggcttg
aacctggtggacgtgcgcgacgtcgccgccgctcatgtcgccgcgttaagcaaaggggaa
aactgcaagcgttacgtcgtgggcggagagaatatcgaggttaaggaaattggcgtcgcc
ttgaagcgccttaccggcgtcaaaccgatccacctgccaactggccgtggcctcactctg
acattcgcccgcgtggtggagacactgtgcaagctgttgcacatcaagccgccgtttacc
tacgacttggtttacgaggtagtgggacgctatgcgtactatgattgcagcgaggcggca
aaagacctgggcgttgaacctcgcgacgcggaagagacgctgaaggactgcatcgcctgg
ctcctgtcccagaataaattaaagcctcgcgtcgccgccaaagtggcgccaaaaatcccc
acgcatcccgcttccgcttga

DBGET integrated database retrieval system