KEGG   Hahella chejuensis: HCH_04897Help
Entry
HCH_04897         CDS       T00307                                 

Gene name
galU
Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
hch  Hahella chejuensis
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hch00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    HCH_04897 (galU)
   00052 Galactose metabolism
    HCH_04897 (galU)
   00500 Starch and sucrose metabolism
    HCH_04897 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    HCH_04897 (galU)
Enzymes [BR:hch01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     HCH_04897 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5032464..5033303
Genome map
AA seq 279 aa AA seqDB search
MIKKCLFPVAGYGTRFLPATKAMPKEMLPVVSKPLVQYGVEEAVAAGMNSFGFVTGRGKR
AIADHFDISYELEQQIKGTGKEELLSSIRSLINNNKFSFTRQNEMKGLGHAILSGQTLIG
DEPFAVVLADDLCMVEEGEDSVLAQMTKLYNQFRCSIVAIQEVPHDEVHKYGVIAGDPMK
EGLFRVTDMVEKPPADQAPSNYAIIGRYILTPDIFDIIRDTEPGKNGEVQVTDALLKQAK
DGCVLAYKFKGRRFDCGSIDGFVEATNYVYENVYKKGLM
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaaagtgtctgtttccggtagctggttacggaacccgattcctgcccgccacc
aaagccatgcctaaagaaatgctgccagtcgtgagcaaaccactggttcagtacggcgtt
gaagaagcagtcgccgctggtatgaactctttcggttttgttaccggccggggtaagcgg
gccattgcggaccactttgatatttcttatgagctggaacaacagatcaagggaaccggc
aaagaagaacttctatccagcattcgcagcctgataaataacaataaattctcattcacc
cgccaaaatgaaatgaaaggtttagggcacgctattctttccggacagaccctgatcggc
gacgagccgttcgcggttgtgcttgcggacgatctctgcatggtggaagaaggcgaagac
agcgtgctggcccagatgaccaagctgtacaatcaattccgttgcagcattgtggccatc
caggaagttccacacgacgaagttcacaagtatggcgtcattgccggcgacccaatgaaa
gaaggcctgttccgcgtcacagacatggtagagaagccacccgccgatcaggctccctcc
aattacgccatcatcggccgctacattctgactccggatatttttgacatcatccgcgac
acagagcccggcaaaaacggtgaagttcaagtgaccgacgccctgctgaagcaagccaaa
gacggttgcgtactggcgtataaattcaaaggacgtcgtttcgactgcggcagcattgac
ggcttcgtcgaagccaccaattatgtttacgagaacgtgtacaaaaaaggcctgatgtaa

DBGET integrated database retrieval system