KEGG   Hahella chejuensis: HCH_04953Help
Entry
HCH_04953         CDS       T00307                                 

Gene name
tesA
Definition
lysophospholipase L1
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
hch  Hahella chejuensis
Pathway
Biosynthesis of unsaturated fatty acids
Class
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:hch01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5085899..5086738
Genome map
AA seq 279 aa AA seqDB search
MMLSSVVLPEPERPIIANDSPTLICRSTPFNISKRPLPLETLFVSDLTSSTSTEVMPATS
FLNLFKRHVIKSVWTLFALCCLMVSPITQAVTDKSQPVKIVVLGDSLSAAYGIPLESGWI
TLMENELSATYPNLTLINASISGETTGGGRARLSALLKEHKPDIVLLELGGNDGLRGFPL
NIIKDNLAAMLDSIADAGAKAMLIGMRIPPNYGPAYAEGFHQIYQDLASEQKVTLVPFLL
DNVALDPSLMQSDGIHPNAKGQPQLVENVLPHLNSLLSH
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgatgctcagcagtgtggtcttgccggagccggagcgtccgataatcgccaacgactcc
cccaccttgatttgcagatcgacgcctttcaatatatccaaacgcccgctaccattggag
acacttttcgtaagcgatttaacctcaagcacatcaaccgaagtcatgccagcaacctca
ttcctcaatctgtttaaacgtcatgtcatcaagtccgtctggactctgtttgcgctctgt
tgcctgatggtaagccctatcacacaggctgtcacagataaatcgcaaccagtaaaaatt
gtcgtgttaggggacagtctcagcgccgcttatggcatccccctggaatccggctggatt
acgctgatggaaaacgagcttagcgccacctaccccaacctcaccctgatcaacgccagc
atttccggcgaaaccaccggcggcggccgcgcccgcctgtcagcgttattgaaggagcac
aaaccggatatcgtccttctggaactgggtggtaacgatggcctgcgtggtttccccctc
aacatcattaaagacaacctggcggctatgctggatagcatcgctgacgccggcgcaaag
gccatgctgatcggcatgcgcattccgcccaattatggaccggcttatgctgaaggattc
catcagatctaccaagacctggccagtgaacaaaaagtcacgttagttcccttcctgctg
gataatgtcgcgcttgatcccagtttgatgcagtccgacgggattcaccccaacgccaag
ggccagccgcaactggtggaaaatgtattgccgcatttaaattctctgctaagtcattga

DBGET integrated database retrieval system