KEGG   Hahella chejuensis: HCH_04953Help
Entry
HCH_04953         CDS       T00307                                 

Gene name
tesA
Definition
lysophospholipase L1
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
hch  Hahella chejuensis
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:hch00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    HCH_04953 (tesA)
Enzymes [BR:hch01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     HCH_04953 (tesA)
   3.1.2  Thioester hydrolases
    3.1.2.-  
     HCH_04953 (tesA)
Lipid biosynthesis proteins [BR:hch01004]
 Fatty acid synthase
  Component type
   HCH_04953 (tesA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5085899..5086738
Genome map
AA seq 279 aa AA seqDB search
MMLSSVVLPEPERPIIANDSPTLICRSTPFNISKRPLPLETLFVSDLTSSTSTEVMPATS
FLNLFKRHVIKSVWTLFALCCLMVSPITQAVTDKSQPVKIVVLGDSLSAAYGIPLESGWI
TLMENELSATYPNLTLINASISGETTGGGRARLSALLKEHKPDIVLLELGGNDGLRGFPL
NIIKDNLAAMLDSIADAGAKAMLIGMRIPPNYGPAYAEGFHQIYQDLASEQKVTLVPFLL
DNVALDPSLMQSDGIHPNAKGQPQLVENVLPHLNSLLSH
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgatgctcagcagtgtggtcttgccggagccggagcgtccgataatcgccaacgactcc
cccaccttgatttgcagatcgacgcctttcaatatatccaaacgcccgctaccattggag
acacttttcgtaagcgatttaacctcaagcacatcaaccgaagtcatgccagcaacctca
ttcctcaatctgtttaaacgtcatgtcatcaagtccgtctggactctgtttgcgctctgt
tgcctgatggtaagccctatcacacaggctgtcacagataaatcgcaaccagtaaaaatt
gtcgtgttaggggacagtctcagcgccgcttatggcatccccctggaatccggctggatt
acgctgatggaaaacgagcttagcgccacctaccccaacctcaccctgatcaacgccagc
atttccggcgaaaccaccggcggcggccgcgcccgcctgtcagcgttattgaaggagcac
aaaccggatatcgtccttctggaactgggtggtaacgatggcctgcgtggtttccccctc
aacatcattaaagacaacctggcggctatgctggatagcatcgctgacgccggcgcaaag
gccatgctgatcggcatgcgcattccgcccaattatggaccggcttatgctgaaggattc
catcagatctaccaagacctggccagtgaacaaaaagtcacgttagttcccttcctgctg
gataatgtcgcgcttgatcccagtttgatgcagtccgacgggattcaccccaacgccaag
ggccagccgcaactggtggaaaatgtattgccgcatttaaattctctgctaagtcattga

DBGET integrated database retrieval system