KEGG   Hahella chejuensis: HCH_05166Help
Entry
HCH_05166         CDS       T00307                                 

Definition
chemotaxis-specific methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
hch  Hahella chejuensis
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:hch00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    HCH_05166
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    HCH_05166
Enzymes [BR:hch01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     HCH_05166
Two-component system [BR:hch02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   HCH_05166
Bacterial motility proteins [BR:hch02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    HCH_05166
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5313687..5314853)
Genome map
AA seq 388 aa AA seqDB search
MTLKVLVVDDSGFFRRRLCEILSSISDVDVVGTASNGREGVEMALKLKPDVITMDYEMPV
MDGITAVKEIMRVQPTPVLMFSSLTYEGARVTFDALEAGAVDFLPKSFEAMSGDASKIKR
LLHDRIKEVSRAKYRMSGASAPASVPQPAKPAAPIPVREPPKPAAPVTRPAEPRAKAPPA
KPEPKPEVKAAKSRRTPRQDYKVVLIGTSTGGPVALQKILTRLPGAFPAPLVLVQHMPAS
FTPAFAERLNRLSQLSVKQAENGEILKPGWAYIAPGGKQTLIERVGAQARVKILDGDERL
HYKPCVDVTFGSCAKMFPGKVLGVILTGMGADGREGCRMLKETGSVVWSQDEATSVIYGM
PMAVATAGLSDEVLALDEFAPRLIDGVG
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaccttaaaggtcctggtagtagatgattcgggatttttcagacgtcgcctttgcgag
atcctgagctccataagcgatgtggatgtcgtcggcacggccagcaatggccgtgaaggc
gtcgagatggcgcttaaactgaaacccgacgtcatcaccatggactacgagatgccggtc
atggacggcattaccgcagtcaaggaaatcatgcgggttcagcccacgccggtgttgatg
ttttcctctcttacctacgaaggcgcccgagtgacctttgacgccctggaagcgggcgcg
gtggattttctgccgaagagcttcgaagcgatgtccggcgacgcctccaagatcaaacga
ctgttgcacgatcgcatcaaagaggtttcgcgggcgaaataccggatgtccggggcgtcc
gcgccggcatccgttcctcagcccgccaagcccgctgcgccgatcccagtgcgcgagccg
cccaagccggccgcgccggttacccgccctgctgagcctcgcgccaaggcgccgccagcc
aaaccggagcctaaacccgaggtgaaggcggcgaagtcccggcgcacgccgcgtcaggac
tataaagtggtgctgataggcacctctaccggcggcccggtggcgttgcagaaaatcctc
acccgtttgcctggcgcgtttcccgcgccgctggtgctggtgcagcacatgccagcgtcc
tttacgccagcatttgctgaacgtttgaaccgtctgtcgcagttgtccgtcaaacaggcg
gagaacggcgaaatcctgaaaccaggatgggcctacattgcgcccggcggcaaacagacg
ctgatagagcgcgttggcgcccaggcgcgggtcaagattctcgacggcgacgagcggttg
cactataaaccctgcgtggacgttactttcggctcctgcgccaagatgtttcccggcaaa
gtactgggcgtcatcctgaccggcatgggcgcggacggccgtgaaggctgccgtatgttg
aaagaaaccggttccgtggtctggtcccaggatgaagcgaccagtgtgatttacggtatg
ccgatggcggtggccaccgccggcctgtcagatgaagttttagccttggatgaatttgcg
ccgcggttgattgacggtgtcggataa

  All links  
No link information was found.   
DBGET integrated database retrieval system