KEGG   Hahella chejuensis: HCH_05246Help
Entry
HCH_05246         CDS       T00307                                 

Gene name
dxr
Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase (EC:1.1.1.267)
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
hch  Hahella chejuensis
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hch00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    HCH_05246 (dxr)
Enzymes [BR:hch01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     HCH_05246 (dxr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5390329..5391540)
Genome map
AA seq 403 aa AA seqDB search
MRRVTVLGATGSIGRSTLDVMARHPDRYELYAATAHSNLNELFSICIKHRPRYAILATDA
GLAGFKKRLRDAGVSTEVRVGVEAMCEASSASDVDVVVAAIVGAAGLVPTLAAVNSGKRI
LLANKEALVMTGRLFMDAVRRHGAELLPIDSEHNAIYQCLPEAGQHLSDMTSLAAYGVTR
VLLTASGGPFRHFSQQQLQQVTPEQACRHPNWSMGRKISVDSASLMNKGLELIEACWLFD
LTPGSVQVHLHPESIIHSMVEYVDGSILAQMGNPDMRTPIAYGLAWPERIDAGVQPLDLF
SIGKLHFEMPDKERFPCLRLAEEAFSLGGTAPAVVNAANEVAVEAFLQGDIRFVDIPVVI
EKSLLKGSIVDADSVETVIEADRVARQYASEAINELAGGVVVP
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgaggcgagttacggtattaggggcgacaggctctatagggcgcagcaccctggatgtt
atggcccgtcacccggatcgatatgagctttatgctgcgacagcccatagtaacttgaat
gagcttttctctatctgcattaagcaccgcccacggtacgccatattggcgactgatgct
ggtttagcgggctttaaaaagcgcttgcgggacgctggtgtgtccactgaagttagagtg
ggcgttgaagccatgtgcgaggcgtcttccgccagcgatgttgatgttgtcgtcgctgct
atagtcggggcggctggattggtccccacactggctgcggtgaactcggggaagcgtata
ctgctcgccaacaaagaagcattagtcatgactggcaggctgttcatggatgcggtgcga
cgacatggcgctgaactccttcccattgatagtgagcataatgcgatttatcagtgtttg
ccggaggctggacaacatttaagtgacatgacatcgcttgccgcatatggcgttactcgc
gtcctcttgacggcgtctggtgggccatttcggcatttttcgcagcagcaattacaacaa
gtaacgccagagcaggcatgtaggcacccgaattggtcgatggggcgtaaaatctctgtt
gattccgcgagcttgatgaataaggggctggagttaatcgaagcatgttggttattcgat
ttgactccaggctcagttcaggttcacttacatcctgagtcgattattcactccatggtt
gagtatgtggatggctctattctggcgcagatgggcaatcctgacatgcgtacgcctatc
gcttatgggttggcttggccggaaagaatagatgcaggcgttcagccgctagatctgttt
tctattggtaagctgcatttcgaaatgcctgataaagaacgctttccctgtcttaggctg
gctgaggaagctttttcgcttggtgggactgcgccagcagtggttaacgctgctaatgag
gtggcggtagaagcgtttctccagggcgatattcgttttgtcgatattcccgtagttatt
gaaaagagtttgctgaaaggttctattgtggatgctgattctgtcgaaactgtaattgaa
gctgacagagtagcccgtcaatatgcctcggaagccattaatgagttggctggcggagtt
gttgttccgtaa

DBGET integrated database retrieval system