KEGG   Hahella chejuensis: HCH_05305Help
Entry
HCH_05305         CDS       T00307                                 

Definition
histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
hch  Hahella chejuensis
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:hch01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:hch00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5448856..5450151)
Genome map
AA seq 431 aa AA seqDB search
MRELDSSQADFKSQLEALLAFQEDDSAEVNRVVENVLKDVRVRGDEAVLEYTNRFDHMSA
TSMSALEIPHHRLQQALASIAPELKSALESAAGRIRRYHERQAQPSWTYQEEDGTVLGQK
VVPLDRVGIYVPGGKAAYPSSVLMNAIPAKVAGVGSIIMTVPTPRGEVNELVLAAAAVAG
VDRVFTVGGAQAVAALAYGTETVPKVDKIVGPGNIYVAMAKRMVFGTVGIDMIAGPSEIC
VVCDGGTDPDWIAMDLFSQAEHDQDAQAILISPDEACLSAVKASIEKLLPDMERKDIISV
SLKERGAFIKVADLDDAIDVVNLIAPEHLELSVADPDALLPGIRHAGAVFMGRYTAEALG
DYCAGPNHVLPTSGTARFSSPLGVYDFQKRSSLINFSSRGASDAGRIASVLARGEGLTAH
ARSAEYRIVEE
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgaactagatagcagtcaggcggattttaagtcgcaactggaagccttgctggcg
tttcaggaagacgacagcgcggaagtgaatcgcgtggtggagaacgtgttgaaagatgtg
cgcgttcgtggtgatgaagcggtattagagtataccaaccgctttgatcatatgagcgcg
acctcaatgagcgccctggaaatcccgcatcatcgactgcagcaggctctcgcctctatt
gctcctgagttgaaaagcgctttggaaagcgccgccgggcgcattcgtcgttatcatgaa
aggcaggcgcaaccctcttggacctaccaagaggaagatggaactgtcctggggcaaaag
gttgttcccttagaccgcgtcggcatttatgtcccgggcggcaaggctgcttatccctct
tctgtgctcatgaacgcgattcccgcgaaagtagcgggtgtgggctccattatcatgact
gtgccgacgcctcgtggcgaagtgaatgaattggtgctcgccgcggcggcggtagccggc
gttgatcgggtgttcactgtcggcggcgcgcaagccgtggcggctttggcctatggcact
gagacggtccccaaggtcgataagattgtcggcccaggcaatatctacgtggctatggcg
aagcgaatggtgttcggaactgttggcatcgacatgattgcagggccctcggaaatctgt
gtggtttgtgatgggggaacggacccagattggatcgctatggacctgttctcgcaggcg
gagcacgaccaggatgctcaggcgatacttatctcaccagatgaagcctgtctgtctgcg
gtgaaagcatccattgaaaagctgctgccggacatggagcgcaaagatattatttcagtt
tctttaaaagagcggggcgcctttatcaaagtcgctgacctggatgacgccattgacgtg
gttaaccttatcgcgccggagcacttggagctttcggttgctgacccggatgcgttgctt
cctggaatcaggcatgccggcgccgtatttatggggcgttatacggcggaagcattgggg
gactattgcgcggggccgaaccacgtgttgccgacgtctggaaccgcacgtttctccagt
cctttgggggtatatgacttccagaagcgttcatccctgatcaatttctccagtcgcggc
gcctccgacgctgggcgaattgcttctgtgctcgcgcgtggagaagggctgaccgcccac
gcgcgctccgcagaatatcgcatagtcgaggagtag

DBGET integrated database retrieval system