KEGG   Hahella chejuensis: HCH_05407Help
Entry
HCH_05407         CDS       T00307                                 

Definition
(GenBank) Outer membrane phospholipase A
  KO
K01058  phospholipase A1/A2 [EC:3.1.1.32 3.1.1.4]
Organism
hch  Hahella chejuensis
Pathway
hch00564  Glycerophospholipid metabolism
hch00565  Ether lipid metabolism
hch00590  Arachidonic acid metabolism
hch00592  alpha-Linolenic acid metabolism
hch01100  Metabolic pathways
hch01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hch00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    HCH_05407
   00565 Ether lipid metabolism
    HCH_05407
   00590 Arachidonic acid metabolism
    HCH_05407
   00591 Linoleic acid metabolism
    HCH_05407
   00592 alpha-Linolenic acid metabolism
    HCH_05407
Enzymes [BR:hch01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     HCH_05407
    3.1.1.32  phospholipase A1
     HCH_05407
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PLA1 VasI
Motif
Other DBs
NCBI-ProteinID: ABC32076
UniProt: Q2SB98
Position
complement(5546985..5548004)
Genome map
AA seq 339 aa AA seqDB search
MRWGVCLLLLGAATVFAEENEAPILACYELDDIQQRLQCYDRVAKSLGEEDEPQTSAIEA
HHEDPLGDIRQPSDIDKRLEFETSLSDNRFLIIPHKPNYLLLYSYVDDPNEMPHSPTREP
IMELESQKHSETKFQISFKVQLARNFIPEPMSLWFAYTQVSFWQLYNQSLSAPFRETNYE
PELIFLFRNNLSLFGYTSEHYVLGLSHQSNGRTEPASRSWNRIYTAFLFNQGSMTFSVKP
WWRLPESGDDDDNPDIHNYMGYAEFGATYKHDENVASLRLFNNFRRNDNHTTVQLSYSFP
LQGRLKGYIEYYDGYGESLIDYNHRTQRIGFGVLLTDWY
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgcgttggggagtgtgtcttttgctactcggggcggcgacggttttcgccgaagaaaat
gaggcgcctatattggcgtgctatgaattagacgatatacagcaacgtctgcaatgctat
gacagggtcgcaaaatccttgggcgaagaggacgagccccaaacgagcgcgatagaagcg
catcatgaggaccccctcggtgatatcaggcagccaagcgacatcgacaagcgcttggag
tttgaaacctctctctcagacaaccgctttctgattattcctcataagcccaactacttg
ctgttgtactcctatgtggacgaccccaacgaaatgcctcatagcccgaccagagaaccc
ataatggagctggagagccagaagcattcggagactaagtttcagatcagtttcaaagtg
caactggcgcgtaactttattcccgagccgatgagcctatggttcgcctacacccaggtt
tcgttctggcagctgtataaccagtcgttgtcggcccctttccgggaaaccaattacgag
cccgaactgatctttttgttccgtaataacctgagcctgttcggctacacctccgagcat
tacgtgttgggattgagtcatcagtctaatgggcgcaccgagccggcgtcacgaagctgg
aaccgcatctacactgcatttctgttcaaccagggcagcatgactttcagcgtcaaaccc
tggtggcgtctgccggaaagcggtgatgacgacgacaaccccgacattcacaactatatg
gggtacgcagagtttggagcgacctacaagcatgatgagaacgtggccagcctgcgcctg
ttcaacaacttccgccgtaatgacaaccacacaacggtgcagctgtcttatagcttcccg
ctacaaggacgcttgaaggggtatatcgagtattacgatgggtatggcgagagtttgatt
gactacaaccatcgcacgcaaaggattggctttggggtgttgctcacagactggtactaa

DBGET integrated database retrieval system