KEGG   Hahella chejuensis: HCH_06054Help
Entry
HCH_06054         CDS       T00307                                 

Definition
glutamine-hydrolyzing asparagine synthase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
hch  Hahella chejuensis
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:hch00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6197291..6199183
Genome map
AA seq 630 aa AA seqDB search
MSGIAGLYHAKKIVTDADLRAMSDAMSHRGPDGSNVWRQAQLGFCHNMLHTTPESLFEAL
PAESHDQRVVITADARLDNRKELACALGINRSDLPLLSDSQLILMGYLHWDLACVSQFLG
DFCFAIWDKDRRRLFIAMDPMGTRSLLYFHSPDLFAFATDVKALLAAPGVDKKLDESGFV
LLASGRRREAPERTCFEGITRLTGGERLCVHPPSSGQAGWKIEKRSYYTLQPETLNFKHP
EEMLEAFREKFRLAVTCRMRSAFPVATLLSGGLDSSAISCMAADQRRHFSHPLIALSSCL
TDQDPEQDERRFISIVARQKQLPVHYVTPTSGPAALLHQVHDMTGLPVNLNPHVYTALYA
KAQSEGARIVMDGVCGEWGPSWTGEGYLQYLLQQLHWKTLKETVLSLSQNYSQSPHRVFQ
NDVLAPLEPRFLRNIRYKLRGRSVEENRLPLTNRLYHQHAAPPPEAKSSDKSLLGKRLNV
ILGGRTPREWYSPHFHIRNTFPYLDERVLKFCLGLSDEWFIQKGWRRYFIRAAMEKTLPP
EIQWRRDKRPFSPNYHRLMQTDAPVYESIVQDVSPSDPVRDYIDVERIKRTIKELNQRPS
WGPYNGVDFARKVVDFGVQSLIFLRWFQRL
NT seq 1893 nt NT seq  +upstreamnt  +downstreamnt
atgagtggtatcgctgggttataccatgcaaaaaaaatcgtcactgacgcagaccttcgc
gccatgtcagacgccatgtcgcaccgaggcccggatggaagcaatgtttggcggcaggcg
cagctcggcttttgtcacaacatgctgcacaccacgccagagtctttgtttgaagcattg
cccgcagagtcgcatgaccagcgagttgtaattaccgcagatgctcgcctggacaaccga
aaagagcttgcctgcgcactgggaataaatcgaagcgacttgcccctgctgagtgacagc
caactcattcttatgggttatcttcattgggatttggcgtgtgtgagccaatttctgggc
gatttctgtttcgccatctgggacaaagacaggcgtcgcctgtttatcgctatggacccg
atgggaacccggtcgctactctatttccactcccctgacctatttgctttcgcaacagat
gtcaaagccttgctagccgccccgggagtggacaaaaagctggatgagtcggggtttgtc
cttctggcgtcaggtcgcagacgggaagcgcctgagcgcacatgctttgaaggcataacc
aggcttaccggcggcgagcgcttatgcgttcatcctccctcttccgggcaagcaggttgg
aagattgagaaacgcagttactacactctccaacctgaaacgctcaacttcaaacatcca
gaggaaatgcttgaggcgtttcgagagaaattccgactggcggtgacttgccgaatgcgc
agcgccttccccgtagccacgcttcttagcggcggactggattcttccgctatcagctgc
atggccgctgaccagcggcgccacttctcccatccccttatcgcactgtcatcctgcctg
acagatcaagatcctgagcaggatgaaagacgatttattagtatcgttgcgcgccaaaag
cagttgcctgttcattacgtaacgcccacgtccggtcccgccgcgttactgcaccaagta
cacgacatgaccggccttcccgttaacctcaatccacatgtctatacagcgctctacgcc
aaagcgcagagtgagggcgcccgcattgtaatggatggcgtctgcggcgagtggggaccc
agctggactggagagggttatttacagtatttgctacaacaactgcattggaaaacactg
aaggaaacagtcctcagtttgtctcaaaactattcccagtctcctcacagggtattccag
aacgacgttctagctccattggaacccaggttcctccgcaatatacgatataaattgaga
gggcgctcggtagaggaaaacaggcttcccctgaccaacagactctaccatcaacatgcg
gccccaccgcctgaggccaagtcatcagacaagtcgcttctgggaaaacggctaaatgtc
atacttggtggccgcacgcctagagaatggtattcaccacactttcatattcgcaacacc
tttccttatttagatgagcgggtattaaagttttgcctggggttgtcggatgaatggttc
atacagaaaggctggcgccgttatttcattcgcgccgcgatggaaaaaacgcttcctcca
gaaattcaatggcgtagagataaaagacctttttcgccaaattatcacaggctgatgcaa
actgacgcccctgtctacgagagtattgttcaagacgtttctccatcagatccggtaaga
gactatattgatgttgaaaggatcaaacgcacgataaaagagctcaatcaacgcccttca
tggggaccatacaacggcgtcgatttcgcgaggaaagtggtggatttcggggtacagagc
ctgatatttcttcgctggtttcagcgactctag

DBGET integrated database retrieval system