KEGG   Hahella chejuensis: HCH_06263Help
Entry
HCH_06263         CDS       T00307                                 

Gene name
folK1
Definition
(GenBank) 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
  KO
K00950  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
hch  Hahella chejuensis
Pathway
hch00790  Folate biosynthesis
hch01100  Metabolic pathways
Module
hch_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:hch00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    HCH_06263 (folK1)
Enzymes [BR:hch01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     HCH_06263 (folK1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HPPK DUF4390
Motif
Other DBs
NCBI-ProteinID: ABC32910
UniProt: Q2S8W4
Position
6401847..6402329
Genome map
AA seq 160 aa AA seqDB search
MTICYVGLGSNLSQPEQQLRQALSALKDISGVQLLQASSLYRSAPLGAPDQPWYVNAVAQ
LETSLEPLALLRELQTIENSQGRVRQGERWSPRTLDLDLLLFGEQTIDSEALTVPHYAMH
ERNFVIFPLAEIAPSCVIPGIGSISALLATLPQEGIERME
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgacaatctgctatgtcggcctgggtagcaacctaagccagcctgagcaacagctgcgc
caagcgctaagcgcattgaaagatatatccggagttcagttgttgcaggcgtccagcctg
tatcgcagtgcgccactcggcgcgcctgaccagccctggtatgtcaacgctgtcgcgcaa
ctggaaaccagtctggagcctctcgccctgttgcgagagctgcaaacgatcgagaacagt
caggggcgcgtacgccaaggcgaacgctggagccccagaactctggatttggatttgctc
ttatttggcgaacagaccatagacagcgaagcactgaccgttcctcactacgcaatgcac
gagcgtaacttcgttatatttcccttggctgaaattgcgccgagctgcgttattccgggc
atcggatcgatatccgcgctgcttgcgacattgccgcaagaaggcattgagcgtatggag
taa

DBGET integrated database retrieval system