KEGG   Hahella chejuensis: HCH_06315Help
Entry
HCH_06315         CDS       T00307                                 

Definition
(GenBank) Guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
hch  Hahella chejuensis
Pathway
hch00230  Purine metabolism
hch01100  Metabolic pathways
Module
hch_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:hch00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    HCH_06315
Enzymes [BR:hch01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     HCH_06315
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_33 AAA_16 AAA_18 RsgA_GTPase ABC_tran AAA_22 AAA MMR_HSR1 AAA_23 cobW
Motif
Other DBs
NCBI-ProteinID: ABC32962
UniProt: Q2S8R2
Position
complement(6454297..6454923)
Genome map
AA seq 208 aa AA seqDB search
MARGQLYIISAPSGAGKTSLVSALLKEDKLAQVSISHTTRQVRPGEQDGVNYFFISREEF
LAQAQAGDFLEHAEVFGNFYGTSQAWVESTLAKGVDVILEIDWQGAQQVRKLRPEAKSIF
ILPPSLEALQQRLESRGQDSAEVIQRRLQEAANEISHYPEYDYLVFNDDFDHALEELKSV
FRAERLRLSVQQVRFEAELRGMLSSQSS
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atggccagaggtcagttatatattatttcagcgccctccggggcgggtaagaccagtttg
gtgtcggctttactcaaagaagataaactggcgcaagtctccatttcccacacgactcgt
caggtgcgtccaggtgaacaggatggagtgaattactttttcatctcccgcgaagagttt
ctggcgcaggctcaggcgggagacttcctggagcacgcggaagtgttcggcaatttctac
ggcacgtcgcaggcatgggtggagtccactttggcgaaaggcgttgacgttatcctggaa
attgactggcagggcgcgcaacaggtgcgcaagttgcgtccagaagccaaatccatattc
atcctgccgccttctctggaagccttgcaacagcgcctggagtctcgcgggcaggacagc
gccgaagtgattcagcgtcgtttgcaggaagcggctaatgaaatttcccattatccggaa
tacgactatcttgtattcaacgacgacttcgatcatgcgctggaagaattgaagtccgtt
ttccgggctgagcggctgcgtttgtccgtgcagcaggtgcgcttcgaagcagagctacgc
gggatgttgtcatcccagtcgagttag

DBGET integrated database retrieval system