KEGG   Hahella chejuensis: HCH_06439Help
Entry
HCH_06439         CDS       T00307                                 

Definition
phosphomannomutase
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
hch  Hahella chejuensis
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hch00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HCH_06439
   00030 Pentose phosphate pathway
    HCH_06439
   00051 Fructose and mannose metabolism
    HCH_06439
   00052 Galactose metabolism
    HCH_06439
   00500 Starch and sucrose metabolism
    HCH_06439
   00520 Amino sugar and nucleotide sugar metabolism
    HCH_06439
  Nucleotide metabolism
   00230 Purine metabolism
    HCH_06439
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    HCH_06439
Enzymes [BR:hch01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     HCH_06439
    5.4.2.8  phosphomannomutase
     HCH_06439
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6575483..6576829)
Genome map
AA seq 448 aa AA seqDB search
MDLSCFKAYDIRGRVPDQLNNDIAERIGRAYVEVTGAKKVVVGYDIRLSSPAMAEALSKG
LMAAGADVYDIGLCGTEQVYFATFYHKMDGGIMVTASHNPQDYNGMKLVGVDSRPISSDT
GLLDIKGKVPGEFKDAEKPGSYHKLDTLEAYIQHLLTYVDASALKPMKVVVNAGNGGAGL
VIDELEKHLPFTFVKVHHEPDGHFPHGVPNPLLMENRDSTRSALLESGADFGVAWDGDYD
RCFLFDETGRFIEGYYIVGLLAEQLLSKHPGAGIIHDPRLVWNTIDVVEAAGGKAIQSKT
GHAFIKQRMRDEDAVYGGEMSAHHYFRDFAYCDSGMIPWLMVADLISATGKSLSSLIDDR
MKKYPASGEINRTLEDAGKVLKAIEEEYAPKAKSVNFVDGLSVEFDDWRFNLRMSNTEPL
VRLNVESRGDQALMEAKTAELLEKIDSI
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atggatcttagctgtttcaaagcctatgacatcagaggccgcgtgcctgaccagctgaat
aacgatatcgcggaacggattggccgcgcctatgttgaggtgaccggagctaagaaagta
gtggttggctatgacatccgcctgtccagtccggctatggccgaagccttaagcaaaggc
ctgatggcggccggcgccgatgtttacgacatcggtttatgcggcacagagcaggtgtat
ttcgcgactttctatcacaaaatggacggcggcatcatggtgaccgccagccacaacccc
caggattacaacggcatgaagctggttggcgtggattcccgcccgattagttccgatacc
ggcctgttggatatcaaaggcaaagtgccgggcgagttcaaagacgccgaaaagccaggc
tcctatcacaagctggacactctggaagcctatattcagcacctgctgacttacgttgac
gcctctgcattgaagccgatgaaagtcgtggtcaacgccggtaacggcggcgcgggtctg
gttatcgatgagctggaaaaacacctgccgttcaccttcgtcaaagtacatcacgagccg
gacggacacttcccgcatggggtgcctaaccctcttttgatggaaaaccgcgacagcact
cgttctgcgttgctggaatctggcgctgacttcggcgtggcttgggacggcgactatgac
cgctgtttcctgttcgacgaaaccggacgcttcattgaaggttactacatcgtaggtttg
ctggcggagcagttgctgagcaagcaccctggcgcgggcatcattcacgatccgcgtctg
gtctggaacaccatcgacgtggttgaagcggcaggcggcaaagccatccagagcaaaacc
ggacatgccttcatcaagcagcgtatgcgtgatgaagacgcggtatatggcggcgaaatg
agcgcgcatcactacttccgtgacttcgcctactgcgactcaggcatgatcccctggttg
atggtggcggacctgatcagcgctaccggcaagtcgctgtccagtttgattgacgaccgc
atgaaaaagtatcccgccagcggtgaaatcaaccgtaccctggaagatgcgggcaaagtg
ctgaaagccatcgaggaagaatacgcgcccaaggcgaaatccgtgaatttcgtggatggc
ctgagtgtggaattcgacgactggcgctttaacctgcgtatgtccaacaccgagcctttg
gtgcgcttgaacgttgagtctcgtggggatcaggcgttgatggaggccaagacggcggaa
ctgctggaaaagatcgacagcatctga

DBGET integrated database retrieval system